NGFR (nerve growth factor receptor)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4804
• Gene name: Nerve growth factor receptor
• Gene symbol: NGFR
• Synonyms (NCBI Gene): CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
• Chromosome: 17
• Chromosome location: 17q21.33
• Summary: Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic

miRNA Show/Hide all (104)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016762	hsa-miR-335-5p	Microarray	18185580
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT472231	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT472230	hsa-miR-1321	PAR-CLIP	23592263
MIRT472229	hsa-miR-4739	PAR-CLIP	23592263
MIRT472228	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT472227	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT472226	hsa-miR-1972	PAR-CLIP	23592263
MIRT472224	hsa-miR-4270	PAR-CLIP	23592263
MIRT472225	hsa-miR-4441	PAR-CLIP	23592263
MIRT472223	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT472222	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT472221	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT472220	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT472218	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT472219	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT472217	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT472216	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT472215	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT472213	hsa-miR-4651	PAR-CLIP	23592263
MIRT472214	hsa-miR-608	PAR-CLIP	23592263
MIRT472212	hsa-miR-363-5p	PAR-CLIP	23592263
MIRT472211	hsa-miR-6745	PAR-CLIP	23592263
MIRT472210	hsa-miR-3978	PAR-CLIP	23592263
MIRT1184143	hsa-miR-1827	CLIP-seq
MIRT1184144	hsa-miR-1909	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT1184147	hsa-miR-28-5p	CLIP-seq
MIRT1184148	hsa-miR-3139	CLIP-seq
MIRT1184149	hsa-miR-3150a-3p	CLIP-seq
MIRT1184150	hsa-miR-3175	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT1184153	hsa-miR-3670	CLIP-seq
MIRT1184154	hsa-miR-3936	CLIP-seq
MIRT1184155	hsa-miR-3943	CLIP-seq
MIRT1184156	hsa-miR-4277	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT1184159	hsa-miR-4688	CLIP-seq
MIRT1184160	hsa-miR-4722-3p	CLIP-seq
MIRT1184161	hsa-miR-4727-5p	CLIP-seq
MIRT1184162	hsa-miR-4768-5p	CLIP-seq
MIRT1184163	hsa-miR-498	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184166	hsa-miR-708	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT1184168	hsa-miR-939	CLIP-seq
MIRT1184169	hsa-miR-942	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT1184145	hsa-miR-214	CLIP-seq
MIRT2053383	hsa-miR-2467-3p	CLIP-seq
MIRT2053384	hsa-miR-3126-5p	CLIP-seq
MIRT2053385	hsa-miR-3173-3p	CLIP-seq
MIRT2053386	hsa-miR-3184	CLIP-seq
MIRT1184151	hsa-miR-3612	CLIP-seq
MIRT1184152	hsa-miR-3619-5p	CLIP-seq
MIRT2053387	hsa-miR-377	CLIP-seq
MIRT2053388	hsa-miR-3941	CLIP-seq
MIRT2053389	hsa-miR-423-5p	CLIP-seq
MIRT2053390	hsa-miR-4324	CLIP-seq
MIRT1551751	hsa-miR-4459	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053392	hsa-miR-466	CLIP-seq
MIRT2053393	hsa-miR-4672	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2053395	hsa-miR-4695-5p	CLIP-seq
MIRT2053396	hsa-miR-4779	CLIP-seq
MIRT1184165	hsa-miR-650	CLIP-seq
MIRT1184167	hsa-miR-761	CLIP-seq
MIRT2282604	hsa-miR-186	CLIP-seq
MIRT1184146	hsa-miR-2277-3p	CLIP-seq
MIRT2282605	hsa-miR-2964a-3p	CLIP-seq
MIRT1184157	hsa-miR-4447	CLIP-seq
MIRT1184158	hsa-miR-4472	CLIP-seq
MIRT2282606	hsa-miR-4505	CLIP-seq
MIRT2053391	hsa-miR-4514	CLIP-seq
MIRT2053394	hsa-miR-4692	CLIP-seq
MIRT2282607	hsa-miR-513a-5p	CLIP-seq
MIRT1184164	hsa-miR-516b	CLIP-seq
MIRT2391537	hsa-miR-2681	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYCN	Repression	21123453

Gene ontology (GO) Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	TAS	26871627
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0001678	Process	Intracellular glucose homeostasis	ISS
GO:0001942	Process	Hair follicle development	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	1846035
GO:0005035	Function	Death receptor activity	IBA
GO:0005035	Function	Death receptor activity	IEA
GO:0005035	Function	Death receptor activity	IGI	11927634
GO:0005515	Function	Protein binding	IPI	11756426, 14593116, 14966521, 14985763, 19131967, 20659559, 21982860, 23559013, 32814053
GO:0005516	Function	Calmodulin binding	IDA	24914971
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16712417
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3022937
GO:0005911	Component	Cell-cell junction	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	16712417
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0015026	Function	Coreceptor activity	IBA
GO:0015026	Function	Coreceptor activity	IDA	16712417
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11927634
GO:0016048	Process	Detection of temperature stimulus	IEA
GO:0021675	Process	Nerve development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	27927008
GO:0030426	Component	Growth cone	IEA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031267	Function	Small GTPase binding	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0035907	Process	Dorsal aorta development	IEA
GO:0038023	Function	Signaling receptor activity	TAS	3022937
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042488	Process	Positive regulation of odontogenesis of dentin-containing tooth	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043121	Function	Neurotrophin binding	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043226	Component	Organelle	IEA
GO:0043588	Process	Skin development	IEA
GO:0045202	Component	Synapse	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048406	Function	Nerve growth factor binding	IBA
GO:0048406	Function	Nerve growth factor binding	IEA
GO:0048406	Function	Nerve growth factor binding	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0051402	Process	Neuron apoptotic process	IGI	11927634
GO:0051799	Process	Negative regulation of hair follicle development	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IDA	26268439
GO:0098793	Component	Presynapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	26268439
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	26268439
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	26268439
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11927634
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	26268439
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 162010
• HGNC: 7809
• e!Ensembl: ENSG00000064300

Protein

• UniProt ID: P08138
• Protein name: Tumor necrosis factor receptor superfamily member 16 (Gp80-LNGFR) (Low affinity neurotrophin receptor p75NTR) (Low-affinity nerve growth factor receptor) (NGF receptor) (Low-affinity nerve growth factor receptor p75NGFR) (Low-affinity nerve growth factor
• Protein function: Low affinity receptor which can bind to NGF, BDNF, NTF3, and NTF4. Forms a heterodimeric receptor with SORCS2 that binds the precursor forms of NGF, BDNF and NTF3 with high affinity, and has much lower affinity for mature NGF and BDNF (PubMed:24
• PDB: 2N80 , 2N83 , 2N97 , 3EWV , 5ZGG , 7CSQ , 8X8T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00020	TNFR_c6	149 → 188	TNFR/NGFR cysteine-rich region	Domain
  PF00020	TNFR_c6	109 → 146	TNFR/NGFR cysteine-rich region	Domain
  PF00531	Death	344 → 421	Death domain	Domain
  PF18422	TNFR_16_TM	246 → 283	Tumor necrosis factor receptor member 16 trans-membrane domain	Domain

• Sequence:

  MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
  QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
  RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
  TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
  PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
  LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
  HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
  STATSPV

• Sequence length: 427

Pathways

KEGG Pathway	Reactome Pathway
Virion - Ebolavirus, Lyssavirus and Morbillivirus	Axonal growth inhibition (RHOA activation)
MAPK signaling pathway	Regulated proteolysis of p75NTR
Ras signaling pathway	NFG and proNGF binds to p75NTR
Rap1 signaling pathway	NADE modulates death signalling
Cytokine-cytokine receptor interaction	NRIF signals cell death from the nucleus
PI3K-Akt signaling pathway	p75NTR recruits signalling complexes
Apoptosis - multiple species	NF-kB is activated and signals survival
Neurotrophin signaling pathway	Axonal growth stimulation
Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (12)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	19416921	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	30339727	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	12097334	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17409433, 18056468	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	10436046	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (256)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	16173964, 3006050		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16173964		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	3006050		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31019292		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	16077909, 16826429, 17550129, 2172988, 26497209, 29930101, 8437665		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	16539663, 22236693, 26738357, 28558704, 31745181, 36074475, 36189598	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	27737362	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	8221061		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28506859		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	35309353	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	25330297	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26355501	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33673283, 35309353	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1649553	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17971243		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28506859		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	28630479	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28630479		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24736721		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28506859		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29459824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12672029		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15342406		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	32917932	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	1649553, 24519935, 36435874	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	28852061	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11389056, 17617666, 18716795, 25963139		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10606728, 17617666, 18716795, 22161836, 23677713, 23831066, 26673618, 40629424	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16424897	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22558167	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	2475341		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33378013, 36785674	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16424897	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15342406		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29055389		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27120782	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28928825		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	7828981	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar medulloblastoma	Cerebellar medulloblastoma	BEFREE	9420431		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29499660	Associate	★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease, Type Ia (disorder)	Charcot-Marie-Tooth disease	BEFREE	8931571		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	16077909, 16826429, 17550129, 2172988, 26497209, 29930101, 8437665		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	9658722		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	26278479	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25816145		★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	16299227, 28426529		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25153701, 26991827		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26398439		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33140821	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25244921		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25244921, 26494939, 29945573, 32235004, 33820868, 34541005, 36890467	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	28426529		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27120782		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	24252413	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	12097334		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	12097334		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28253191, 29118440, 31132579		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	26738357	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15274039, 31493120		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	15274039, 15883381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	26278479	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	16586073		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18566344		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18566344, 31768712		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22236693	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	31113619		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	8926497		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	8926497		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28570737		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	26278479		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	12821676	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18061173	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18976764	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28673205		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27913431		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16832412, 25351876, 26897248, 31698654	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	2171417		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	31132579	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25816145		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29867188		★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	25418464	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19288188, 24519935, 27927008, 33351787, 34899682, 35393432	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30731398		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10728904, 30731398		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10360476, 22558167, 23576602, 26119933		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	1649553, 22558167, 24519935	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17696644		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23576602	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease, Chronic, X-Linked	Granulomatous Disease	BEFREE	12804147		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	20852592		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	23626764, 27469492, 31325530		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	23799134, 33229797, 8696348	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	11854929, 7828981	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1310894		★☆☆☆☆ Found in Text Mining only
HSAN Type IV	Hereditary insensitivity to pain with anhidrosis	BEFREE	10774995, 11719521, 27551041, 8696348		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27823570, 29860333		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35925599	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	16424897	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	33600668	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35163127	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21178826		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23626764		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25153701, 26991827		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27551041		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30842475		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	29779037		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29499660, 29744773		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	16275928	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Keratoconus	BEFREE	23489213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	LHGDN	19169037		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	28426529		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27120782	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	16906282	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10720142, 16173964, 26991827		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	18403643	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	3006050	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	3006050	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29208672		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15523689		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15523689		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	21212030, 25816145	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25816145		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25816145	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29802376	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31698654	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34569899	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18081157, 26278479, 28375203, 28761093, 31477685, 31493120		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31594826		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15084380		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11389056, 17617666, 18716795, 25963139		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27120782		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29055389		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29208672		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28928825		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15944784, 23300742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10637439, 11911243, 15517907, 17143529, 29715200		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17409433, 18056468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31331058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15342406		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11027413, 15342406, 17143529, 21123453, 22419851, 23576602, 24226422, 25351876, 25916394, 27325642, 27469492, 29597090, 29779037, 29930101, 31742606		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16510576		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26398439		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12604596		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16077909, 16826429, 17550129, 2172988, 26497209, 29930101, 8437665		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	16826429		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26497209, 7526237, 9420431	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	29678478, 30339727		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18305571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	18305571, 1850772, 21418516, 22157936, 24390218, 25105565, 25223735, 25351876, 25830652, 26494317, 27477289, 28852061, 31118427, 35163127, 35457078, 36174713, 36435874, 37796710, 37889972, 8305739	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	20596026, 22286766, 24226422, 24799129, 25105565, 25351876, 25769726, 26387540, 27325642, 27328305, 28067893, 28112719, 28435246, 28775208, 28852061, 29215016, 29358574, 29660313, 29678478, 3024814, 30251808, 30339727, 31118427, 31325530, 31565480, 7847808, 8305739, 8908597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	24226422	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	25674270	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory disorders	Pubtator	26738357	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	15883381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	31493120		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27477289		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29378005		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18976764	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	35925599	Associate	★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic dysplastic kidney	Pubtator	27737362	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17626627	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes, Congenital	Myasthenic Syndrome	BEFREE	29700358		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22710983	Associate	★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	10720142		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	18403643	Stimulate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26806620	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28083995		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11911243, 15517907, 15880586, 16951226, 17143529, 17971243, 20596026, 22419851, 22558167, 23300742, 23576602, 24590808, 24736663, 25244921, 25561796, 27469492, 27683113, 27987372, 28069687, 28426529, 28435246, 28560678, 28819854, 29678478, 29779037, 29904026, 29930101, 31019292, 31325530, 31331058, 8437665, 8441429		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28426529		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27913431		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	21150695		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1314950, 1325279, 14699967, 15015775, 1963076, 21123453, 21129533, 21150695, 2156211, 2167446, 22253825, 24736663, 2545334, 25505154, 27804051, 3024814, 8397102, 8433391, 8441429, 8481906, 8707412, 9136990, 9516854, 9739014, 9822157		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1314950, 21419569, 22253825, 23314735, 24253178, 24736663, 26843908, 7526237, 8441429	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	1649553	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32917932, 33253821	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	12097334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	2171417, 2545334, 28426529		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	2884037, 2896630, 29941005, 3130306		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	25189642	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	9650752		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	29678478		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31132579, 32636407	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	32636407	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27863492		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28928825		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23300742		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16704535		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23300742		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27792755, 33820868	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12741461		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19883730		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	29891189		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	28761093		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	35746645	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29052090, 29955238, 30941646, 31159890		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31159890, 33253821	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31159890		★☆☆☆☆ Found in Text Mining only
Pemphigoid Benign Mucous Membrane	Benign mucous membrane pemphigoid	Pubtator	26569118	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	20472890, 9650752		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	20472890		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	28162975	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33622336	Associate	★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	LHGDN	11818506		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	8833656		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10637439, 11911243, 15517907, 17143529, 29715200		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11442674	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11911243		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17409433, 18056468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	27120782		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27120782		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15310753		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	23283492	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	18212050	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18470533, 24736721		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18470533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18470533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwannomatosis	Schwannomatosis	Pubtator	26657314	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	16258511	Associate	★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12213675		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	2456020		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16951226, 18540978		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27683113, 30895287, 31742606		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16951226, 25351876, 27489353, 28560678, 28819854, 31698654		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28447720, 29904026, 31569361, 35925599	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	29779037		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31019292		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29208672, 29904026, 31569361, 31742606		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	31019292		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22688186		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17510309, 17603629		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35758042	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29499660	Associate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	29867188		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	1362425	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	29037860	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29037860	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	33600668	Inhibit	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30307573		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31839752		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18081157, 31493120		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38016691	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	27565163	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	29117739		★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	10436046		★☆☆☆☆ Found in Text Mining only
Vitamin B 12 Deficiency	Vitamin b deficiency	Pubtator	19959661	Stimulate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30664180	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

AGPAT3 2 shared diseasesDegenerative disorder, Neurodegenerative disorder 3 shared evidence sourcesDisgenet (Degenerative disorder), CTD (Neurodegenerative disorder), Disgenet (Neurodegenerative disorder) Related via 2 shared diseases including Degenerative disorder, Neurodegenerative disorder — evidence mostly Disgenet. GSTM4 2 shared diseasesDegenerative disorder, Neurodegenerative disorder 3 shared evidence sourcesDisgenet (Degenerative disorder), CTD (Neurodegenerative disorder), Disgenet (Neurodegenerative disorder) Related via 2 shared diseases including Degenerative disorder, Neurodegenerative disorder — evidence mostly Disgenet. GSTM5 2 shared diseasesDegenerative disorder, Neurodegenerative disorder 3 shared evidence sourcesDisgenet (Degenerative disorder), CTD (Neurodegenerative disorder), Disgenet (Neurodegenerative disorder) Related via 2 shared diseases including Degenerative disorder, Neurodegenerative disorder — evidence mostly Disgenet. APOD 2 shared diseasesDegenerative disorder, Neurodegenerative disorder 3 shared evidence sourcesDisgenet (Degenerative disorder), CTD (Neurodegenerative disorder), Disgenet (Neurodegenerative disorder) Related via 2 shared diseases including Degenerative disorder, Neurodegenerative disorder — evidence mostly Disgenet. IDO1 2 shared diseasesDegenerative disorder, Neurodegenerative disorder 3 shared evidence sourcesDisgenet (Degenerative disorder), CTD (Neurodegenerative disorder), Disgenet (Neurodegenerative disorder) Related via 2 shared diseases including Degenerative disorder, Neurodegenerative disorder — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
AGPAT3	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM4	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM5	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
APOD	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
IDO1	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]

Diseases Linked via Similar Genes

Obesity Linked via 2 of 5 related genesAPOD, IDO1 Intellectual developmental disorder Linked via 1 of 5 related genesAGPAT3 Prostate cancer Linked via 1 of 5 related genesAGPAT3 Autism Linked via 1 of 5 related genesGSTM5 Colonic neoplasms Linked via 1 of 5 related genesGSTM5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obesity	2	["APOD","IDO1"]
Intellectual developmental disorder	1	["AGPAT3"]
Prostate cancer	1	["AGPAT3"]
Autism	1	["GSTM5"]
Colonic neoplasms	1	["GSTM5"]