Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2949
Gene name	Glutathione S-transferase mu 5
Gene symbol	GSTM5
Synonyms (NCBI Gene)	GSTM5-5GTM5
Chromosome	1
Chromosome location	1p13.3
Summary	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

180 Show/Hide all (180)

miRTarBase ID	miRNA	Experiments	Reference
MIRT610530	hsa-miR-99a-3p	HITS-CLIP	23824327
MIRT610529	hsa-miR-99b-3p	HITS-CLIP	23824327
MIRT610528	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT663037	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610530	hsa-miR-99a-3p	HITS-CLIP	23824327
MIRT610529	hsa-miR-99b-3p	HITS-CLIP	23824327
MIRT610528	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610530	hsa-miR-99a-3p	HITS-CLIP	23824327
MIRT610529	hsa-miR-99b-3p	HITS-CLIP	23824327
MIRT610528	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT663037	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT610530	hsa-miR-99a-3p	HITS-CLIP	23824327
MIRT610529	hsa-miR-99b-3p	HITS-CLIP	23824327
MIRT610528	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT610527	hsa-miR-8485	HITS-CLIP	23824327
MIRT610526	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT610525	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT610524	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT1036646	hsa-miR-1254	CLIP-seq
MIRT1036647	hsa-miR-2682	CLIP-seq
MIRT1036648	hsa-miR-3116	CLIP-seq
MIRT1036649	hsa-miR-3134	CLIP-seq
MIRT1036650	hsa-miR-329	CLIP-seq
MIRT1036651	hsa-miR-346	CLIP-seq
MIRT1036652	hsa-miR-3714	CLIP-seq
MIRT1036653	hsa-miR-4266	CLIP-seq
MIRT1036654	hsa-miR-449c	CLIP-seq
MIRT1036655	hsa-miR-4534	CLIP-seq
MIRT1036656	hsa-miR-4652-5p	CLIP-seq
MIRT1036657	hsa-miR-4695-5p	CLIP-seq
MIRT1036658	hsa-miR-4716-3p	CLIP-seq
MIRT1036659	hsa-miR-4779	CLIP-seq
MIRT1036660	hsa-miR-4802-5p	CLIP-seq
MIRT1036661	hsa-miR-622	CLIP-seq
MIRT1036662	hsa-miR-661	CLIP-seq
MIRT1036663	hsa-miR-765	CLIP-seq
MIRT1036650	hsa-miR-329	CLIP-seq
MIRT2240004	hsa-miR-149	CLIP-seq
MIRT2240005	hsa-miR-3064-5p	CLIP-seq
MIRT2240006	hsa-miR-371-5p	CLIP-seq
MIRT2240007	hsa-miR-371b-5p	CLIP-seq
MIRT2240008	hsa-miR-4756-3p	CLIP-seq
MIRT2240009	hsa-miR-4794	CLIP-seq
MIRT2240010	hsa-miR-513c	CLIP-seq
MIRT2240011	hsa-miR-514b-5p	CLIP-seq
MIRT1036661	hsa-miR-622	CLIP-seq
MIRT2543661	hsa-miR-1258	CLIP-seq
MIRT2543662	hsa-miR-127-5p	CLIP-seq
MIRT2543663	hsa-miR-1276	CLIP-seq
MIRT2543664	hsa-miR-130a	CLIP-seq
MIRT2543665	hsa-miR-130b	CLIP-seq
MIRT2543666	hsa-miR-1909	CLIP-seq
MIRT2543667	hsa-miR-301a	CLIP-seq
MIRT2543668	hsa-miR-301b	CLIP-seq
MIRT1036649	hsa-miR-3134	CLIP-seq
MIRT2543669	hsa-miR-3150a-3p	CLIP-seq
MIRT2543670	hsa-miR-3153	CLIP-seq
MIRT2543671	hsa-miR-3160-3p	CLIP-seq
MIRT2543672	hsa-miR-3175	CLIP-seq
MIRT2543673	hsa-miR-3666	CLIP-seq
MIRT1036653	hsa-miR-4266	CLIP-seq
MIRT2543674	hsa-miR-4274	CLIP-seq
MIRT2543675	hsa-miR-4295	CLIP-seq
MIRT2543676	hsa-miR-4300	CLIP-seq
MIRT2543677	hsa-miR-4311	CLIP-seq
MIRT2543678	hsa-miR-4473	CLIP-seq
MIRT1036655	hsa-miR-4534	CLIP-seq
MIRT2543679	hsa-miR-454	CLIP-seq
MIRT1036656	hsa-miR-4652-5p	CLIP-seq
MIRT2543680	hsa-miR-4671-3p	CLIP-seq
MIRT1036657	hsa-miR-4695-5p	CLIP-seq
MIRT2543681	hsa-miR-4706	CLIP-seq
MIRT1036658	hsa-miR-4716-3p	CLIP-seq
MIRT2543682	hsa-miR-4728-5p	CLIP-seq
MIRT2543683	hsa-miR-4749-5p	CLIP-seq
MIRT1036659	hsa-miR-4779	CLIP-seq
MIRT1036660	hsa-miR-4802-5p	CLIP-seq
MIRT2543684	hsa-miR-491-5p	CLIP-seq
MIRT2543685	hsa-miR-583	CLIP-seq
MIRT2543686	hsa-miR-7	CLIP-seq
MIRT2543687	hsa-miR-744	CLIP-seq
MIRT1036663	hsa-miR-765	CLIP-seq
MIRT2543688	hsa-miR-920	CLIP-seq
MIRT2543689	hsa-miR-939	CLIP-seq
MIRT2543661	hsa-miR-1258	CLIP-seq
MIRT2543662	hsa-miR-127-5p	CLIP-seq
MIRT2543663	hsa-miR-1276	CLIP-seq
MIRT2543664	hsa-miR-130a	CLIP-seq
MIRT2543665	hsa-miR-130b	CLIP-seq
MIRT2543666	hsa-miR-1909	CLIP-seq
MIRT2543667	hsa-miR-301a	CLIP-seq
MIRT2543668	hsa-miR-301b	CLIP-seq
MIRT1036649	hsa-miR-3134	CLIP-seq
MIRT2543669	hsa-miR-3150a-3p	CLIP-seq
MIRT2543670	hsa-miR-3153	CLIP-seq
MIRT2543671	hsa-miR-3160-3p	CLIP-seq
MIRT2543672	hsa-miR-3175	CLIP-seq
MIRT2543673	hsa-miR-3666	CLIP-seq
MIRT1036653	hsa-miR-4266	CLIP-seq
MIRT2543674	hsa-miR-4274	CLIP-seq
MIRT2543675	hsa-miR-4295	CLIP-seq
MIRT2543676	hsa-miR-4300	CLIP-seq
MIRT2543677	hsa-miR-4311	CLIP-seq
MIRT2543678	hsa-miR-4473	CLIP-seq
MIRT1036655	hsa-miR-4534	CLIP-seq
MIRT2543679	hsa-miR-454	CLIP-seq
MIRT1036656	hsa-miR-4652-5p	CLIP-seq
MIRT2543680	hsa-miR-4671-3p	CLIP-seq
MIRT1036657	hsa-miR-4695-5p	CLIP-seq
MIRT2543681	hsa-miR-4706	CLIP-seq
MIRT1036658	hsa-miR-4716-3p	CLIP-seq
MIRT2543682	hsa-miR-4728-5p	CLIP-seq
MIRT2543683	hsa-miR-4749-5p	CLIP-seq
MIRT1036659	hsa-miR-4779	CLIP-seq
MIRT2682182	hsa-miR-4786-3p	CLIP-seq
MIRT1036660	hsa-miR-4802-5p	CLIP-seq
MIRT2543684	hsa-miR-491-5p	CLIP-seq
MIRT2543685	hsa-miR-583	CLIP-seq
MIRT2682183	hsa-miR-671-5p	CLIP-seq
MIRT2543686	hsa-miR-7	CLIP-seq
MIRT2543687	hsa-miR-744	CLIP-seq
MIRT1036663	hsa-miR-765	CLIP-seq
MIRT2543688	hsa-miR-920	CLIP-seq
MIRT2543689	hsa-miR-939	CLIP-seq

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	10587441
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	TAS	8473333
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	10587441
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183

MIM	HGNC	e!Ensembl
138385	4637	ENSG00000134201

P46439

Protein name

Glutathione S-transferase Mu 5 (EC 2.5.1.18) (GST class-mu 5) (GSTM5-5)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00043	GST_C	104 → 192	Glutathione S-transferase, C-terminal domain	Domain
PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain

Sequence

MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLN
LKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

Sequence length

218

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	15059925	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	39067062	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	15964507	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (29)
Age related macular degeneration	Age-related macular degeneration	BEFREE	22410570, 25897651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19856098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21692051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36685007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32953885, 34629820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36834424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21156036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36952646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18551009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	26670691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35729618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	22410570	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25897651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19856098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31180245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29471546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31646556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31180245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29471546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35143416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	BEFREE	31646556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33802702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39372720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GSTM4	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
AGPAT3	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM2	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
MGST1	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTO1	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]

GSTM5 (glutathione S-transferase mu 5)

Bookmark This Gene