Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2948
Gene name	Glutathione S-transferase mu 4
Gene symbol	GSTM4
Synonyms (NCBI Gene)	GSTM4-4GTM4
Chromosome	1
Chromosome location	1p13.3
Summary	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

179 Show/Hide all (179)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001461	hsa-miR-16-5p	pSILAC	18668040
MIRT001461	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT540188	hsa-miR-8485	PAR-CLIP	21572407
MIRT540189	hsa-miR-4464	PAR-CLIP	21572407
MIRT540187	hsa-miR-4748	PAR-CLIP	21572407
MIRT540186	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT540185	hsa-miR-8064	PAR-CLIP	21572407
MIRT540184	hsa-miR-3135a	PAR-CLIP	21572407
MIRT540182	hsa-miR-4774-3p	PAR-CLIP	21572407
MIRT540183	hsa-miR-507	PAR-CLIP	21572407
MIRT540181	hsa-miR-557	PAR-CLIP	21572407
MIRT540188	hsa-miR-8485	PAR-CLIP	21572407
MIRT540189	hsa-miR-4464	PAR-CLIP	21572407
MIRT540187	hsa-miR-4748	PAR-CLIP	21572407
MIRT540186	hsa-miR-329-5p	PAR-CLIP	21572407
MIRT540185	hsa-miR-8064	PAR-CLIP	21572407
MIRT540184	hsa-miR-3135a	PAR-CLIP	21572407
MIRT540182	hsa-miR-4774-3p	PAR-CLIP	21572407
MIRT540183	hsa-miR-507	PAR-CLIP	21572407
MIRT540181	hsa-miR-557	PAR-CLIP	21572407
MIRT1036640	hsa-miR-24	CLIP-seq
MIRT1036641	hsa-miR-3198	CLIP-seq
MIRT1036642	hsa-miR-342-3p	CLIP-seq
MIRT1036643	hsa-miR-377	CLIP-seq
MIRT1036644	hsa-miR-4284	CLIP-seq
MIRT1036645	hsa-miR-4309	CLIP-seq
MIRT1556480	hsa-miR-1205	CLIP-seq
MIRT1556481	hsa-miR-1207-5p	CLIP-seq
MIRT1556482	hsa-miR-124	CLIP-seq
MIRT1556483	hsa-miR-1286	CLIP-seq
MIRT1556484	hsa-miR-1909	CLIP-seq
MIRT1556485	hsa-miR-3714	CLIP-seq
MIRT1556486	hsa-miR-3910	CLIP-seq
MIRT1556487	hsa-miR-4722-5p	CLIP-seq
MIRT1556488	hsa-miR-4763-3p	CLIP-seq
MIRT1556489	hsa-miR-506	CLIP-seq
MIRT1556490	hsa-miR-940	CLIP-seq
MIRT2007336	hsa-miR-2467-3p	CLIP-seq
MIRT2007337	hsa-miR-2467-5p	CLIP-seq
MIRT2007338	hsa-miR-3132	CLIP-seq
MIRT2007339	hsa-miR-3188	CLIP-seq
MIRT2007340	hsa-miR-3678-3p	CLIP-seq
MIRT2007341	hsa-miR-3975	CLIP-seq
MIRT2007342	hsa-miR-4267	CLIP-seq
MIRT2007343	hsa-miR-4512	CLIP-seq
MIRT2007344	hsa-miR-4649-3p	CLIP-seq
MIRT2007345	hsa-miR-4731-5p	CLIP-seq
MIRT2007346	hsa-miR-485-5p	CLIP-seq
MIRT2388824	hsa-miR-1252	CLIP-seq
MIRT2388825	hsa-miR-3155	CLIP-seq
MIRT2388826	hsa-miR-3155b	CLIP-seq
MIRT2388827	hsa-miR-3974	CLIP-seq
MIRT2388828	hsa-miR-4476	CLIP-seq
MIRT2388829	hsa-miR-4533	CLIP-seq
MIRT2388830	hsa-miR-484	CLIP-seq
MIRT2388831	hsa-miR-493	CLIP-seq
MIRT2543619	hsa-miR-1206	CLIP-seq
MIRT2388824	hsa-miR-1252	CLIP-seq
MIRT2543620	hsa-miR-1266	CLIP-seq
MIRT2543621	hsa-miR-1302	CLIP-seq
MIRT2543622	hsa-miR-130a	CLIP-seq
MIRT2543623	hsa-miR-130b	CLIP-seq
MIRT2543624	hsa-miR-142-3p	CLIP-seq
MIRT1556484	hsa-miR-1909	CLIP-seq
MIRT2007337	hsa-miR-2467-5p	CLIP-seq
MIRT2543625	hsa-miR-2861	CLIP-seq
MIRT2543626	hsa-miR-2909	CLIP-seq
MIRT2543627	hsa-miR-301a	CLIP-seq
MIRT2543628	hsa-miR-301b	CLIP-seq
MIRT2543629	hsa-miR-3119	CLIP-seq
MIRT2543630	hsa-miR-3127-5p	CLIP-seq
MIRT2007338	hsa-miR-3132	CLIP-seq
MIRT2543631	hsa-miR-3147	CLIP-seq
MIRT2388825	hsa-miR-3155	CLIP-seq
MIRT2388826	hsa-miR-3155b	CLIP-seq
MIRT2007339	hsa-miR-3188	CLIP-seq
MIRT2543632	hsa-miR-3202	CLIP-seq
MIRT2543633	hsa-miR-3591-5p	CLIP-seq
MIRT2543634	hsa-miR-3666	CLIP-seq
MIRT2543635	hsa-miR-3670	CLIP-seq
MIRT2543636	hsa-miR-3689a-3p	CLIP-seq
MIRT2543637	hsa-miR-3689c	CLIP-seq
MIRT2543638	hsa-miR-3918	CLIP-seq
MIRT2388827	hsa-miR-3974	CLIP-seq
MIRT2007341	hsa-miR-3975	CLIP-seq
MIRT2543639	hsa-miR-4255	CLIP-seq
MIRT2543640	hsa-miR-4271	CLIP-seq
MIRT2543641	hsa-miR-4278	CLIP-seq
MIRT2543642	hsa-miR-4295	CLIP-seq
MIRT2543643	hsa-miR-4298	CLIP-seq
MIRT2543644	hsa-miR-433	CLIP-seq
MIRT2543645	hsa-miR-4425	CLIP-seq
MIRT2543646	hsa-miR-4446-3p	CLIP-seq
MIRT2543647	hsa-miR-4473	CLIP-seq
MIRT2388828	hsa-miR-4476	CLIP-seq
MIRT2007343	hsa-miR-4512	CLIP-seq
MIRT2543648	hsa-miR-4518	CLIP-seq
MIRT2543649	hsa-miR-4525	CLIP-seq
MIRT2388829	hsa-miR-4533	CLIP-seq
MIRT2543650	hsa-miR-454	CLIP-seq
MIRT2007344	hsa-miR-4649-3p	CLIP-seq
MIRT2543651	hsa-miR-4656	CLIP-seq
MIRT2543652	hsa-miR-4663	CLIP-seq
MIRT2543653	hsa-miR-4671-3p	CLIP-seq
MIRT2543654	hsa-miR-4709-3p	CLIP-seq
MIRT2543655	hsa-miR-4716-3p	CLIP-seq
MIRT2543656	hsa-miR-4725-3p	CLIP-seq
MIRT2543657	hsa-miR-4728-5p	CLIP-seq
MIRT2543658	hsa-miR-4747-5p	CLIP-seq
MIRT2543659	hsa-miR-4796-3p	CLIP-seq
MIRT2388830	hsa-miR-484	CLIP-seq
MIRT2007346	hsa-miR-485-5p	CLIP-seq
MIRT2388831	hsa-miR-493	CLIP-seq
MIRT2543660	hsa-miR-629	CLIP-seq
MIRT2543619	hsa-miR-1206	CLIP-seq
MIRT2682175	hsa-miR-1224-3p	CLIP-seq
MIRT2388824	hsa-miR-1252	CLIP-seq
MIRT2682176	hsa-miR-1260	CLIP-seq
MIRT2682177	hsa-miR-1260b	CLIP-seq
MIRT2543620	hsa-miR-1266	CLIP-seq
MIRT2682178	hsa-miR-1280	CLIP-seq
MIRT2543621	hsa-miR-1302	CLIP-seq
MIRT2543622	hsa-miR-130a	CLIP-seq
MIRT2543623	hsa-miR-130b	CLIP-seq
MIRT2543624	hsa-miR-142-3p	CLIP-seq
MIRT1556484	hsa-miR-1909	CLIP-seq
MIRT2007337	hsa-miR-2467-5p	CLIP-seq
MIRT2543625	hsa-miR-2861	CLIP-seq
MIRT2543626	hsa-miR-2909	CLIP-seq
MIRT2543627	hsa-miR-301a	CLIP-seq
MIRT2543628	hsa-miR-301b	CLIP-seq
MIRT2543629	hsa-miR-3119	CLIP-seq
MIRT2543630	hsa-miR-3127-5p	CLIP-seq
MIRT2007338	hsa-miR-3132	CLIP-seq
MIRT2543631	hsa-miR-3147	CLIP-seq
MIRT2388825	hsa-miR-3155	CLIP-seq
MIRT2388826	hsa-miR-3155b	CLIP-seq
MIRT2682179	hsa-miR-3176	CLIP-seq
MIRT2007339	hsa-miR-3188	CLIP-seq
MIRT2543632	hsa-miR-3202	CLIP-seq
MIRT2543633	hsa-miR-3591-5p	CLIP-seq
MIRT2543634	hsa-miR-3666	CLIP-seq
MIRT2543635	hsa-miR-3670	CLIP-seq
MIRT2543636	hsa-miR-3689a-3p	CLIP-seq
MIRT2543637	hsa-miR-3689c	CLIP-seq
MIRT2543638	hsa-miR-3918	CLIP-seq
MIRT2682180	hsa-miR-3922-3p	CLIP-seq
MIRT2682181	hsa-miR-3922-5p	CLIP-seq
MIRT2388827	hsa-miR-3974	CLIP-seq
MIRT2007341	hsa-miR-3975	CLIP-seq
MIRT2543639	hsa-miR-4255	CLIP-seq
MIRT2543640	hsa-miR-4271	CLIP-seq
MIRT2543641	hsa-miR-4278	CLIP-seq
MIRT2543642	hsa-miR-4295	CLIP-seq
MIRT2543643	hsa-miR-4298	CLIP-seq
MIRT2543644	hsa-miR-433	CLIP-seq
MIRT2543645	hsa-miR-4425	CLIP-seq
MIRT2543646	hsa-miR-4446-3p	CLIP-seq
MIRT2543647	hsa-miR-4473	CLIP-seq
MIRT2388828	hsa-miR-4476	CLIP-seq
MIRT2007343	hsa-miR-4512	CLIP-seq
MIRT2543648	hsa-miR-4518	CLIP-seq
MIRT2543649	hsa-miR-4525	CLIP-seq
MIRT2388829	hsa-miR-4533	CLIP-seq
MIRT2543650	hsa-miR-454	CLIP-seq
MIRT2007344	hsa-miR-4649-3p	CLIP-seq
MIRT2543651	hsa-miR-4656	CLIP-seq
MIRT2543652	hsa-miR-4663	CLIP-seq
MIRT2543653	hsa-miR-4671-3p	CLIP-seq
MIRT2543654	hsa-miR-4709-3p	CLIP-seq
MIRT2543655	hsa-miR-4716-3p	CLIP-seq
MIRT2543656	hsa-miR-4725-3p	CLIP-seq
MIRT2543657	hsa-miR-4728-5p	CLIP-seq
MIRT2543658	hsa-miR-4747-5p	CLIP-seq
MIRT2543659	hsa-miR-4796-3p	CLIP-seq
MIRT2388830	hsa-miR-484	CLIP-seq
MIRT2007346	hsa-miR-485-5p	CLIP-seq
MIRT2388831	hsa-miR-493	CLIP-seq
MIRT2543660	hsa-miR-629	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	8203914, 8373352
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004364	Function	Glutathione transferase activity	TAS	8349586
GO:0004464	Function	Leukotriene-C4 synthase activity	IDA	27791009
GO:0004464	Function	Leukotriene-C4 synthase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IDA	8373352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	8373352
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0018916	Process	Nitrobenzene metabolic process	IEA
GO:0019899	Function	Enzyme binding	IPI	8373352
GO:0042178	Process	Xenobiotic catabolic process	IDA	8373352
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0042178	Process	Xenobiotic catabolic process	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	IDA	27791009
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	8373352
GO:0043295	Function	Glutathione binding	IDA	8373352

MIM	HGNC	e!Ensembl
138333	4636	ENSG00000168765

Q03013

Protein name

Glutathione S-transferase Mu 4 (EC 2.5.1.18) (GST class-mu 4) (GST-Mu2) (GSTM4-4) (Leukotriene C4 synthase GSTM4) (EC 4.4.1.20)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:8203914, PubMed:8373352). Catalyzes the conjugation of leukotriene A4 with reduced glutathione (GSH) to form leukotriene C4 (PubMed

PDB

4GTU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	105 → 201	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues.

Sequence

MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK

Sequence length

218

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450	Biosynthesis of maresin conjugates in tissue regeneration (MCTR)
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	30217971	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	30217971	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	15964507	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (18)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12114434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19856098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12140136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10868693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35257412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10868693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19718047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12140136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20200426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19856098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12140136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12140136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19718047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35675627	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
AGPAT3	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM5	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
APOD	2	["Degenerative disorder","Neurodegenerative disorder"]	0	[]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
MGST1	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM2	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]

GSTM4 (glutathione S-transferase mu 4)

Bookmark This Gene