Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	2946
Gene name	Glutathione S-transferase mu 2
Gene symbol	GSTM2
Synonyms (NCBI Gene)	GST4GSTMGSTM2-2GTHMUS
Chromosome	1
Chromosome location	1p13.3
Summary	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

174 Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023220	hsa-miR-122-5p	Other	18692484
MIRT025057	hsa-miR-181a-5p	Microarray	17612493
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT1036576	hsa-miR-133a	CLIP-seq
MIRT1036577	hsa-miR-133b	CLIP-seq
MIRT1036578	hsa-miR-3125	CLIP-seq
MIRT1036579	hsa-miR-3150b-3p	CLIP-seq
MIRT1036580	hsa-miR-3185	CLIP-seq
MIRT1036581	hsa-miR-3671	CLIP-seq
MIRT1036582	hsa-miR-3916	CLIP-seq
MIRT1036583	hsa-miR-3921	CLIP-seq
MIRT1036584	hsa-miR-3928	CLIP-seq
MIRT1036585	hsa-miR-4438	CLIP-seq
MIRT1036586	hsa-miR-4493	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT1036588	hsa-miR-4653-5p	CLIP-seq
MIRT1036589	hsa-miR-4689	CLIP-seq
MIRT1036590	hsa-miR-4753-5p	CLIP-seq
MIRT1036591	hsa-miR-4755-3p	CLIP-seq
MIRT1036592	hsa-miR-4784	CLIP-seq
MIRT1036593	hsa-miR-494	CLIP-seq
MIRT1036594	hsa-miR-548ac	CLIP-seq
MIRT1036595	hsa-miR-548ae	CLIP-seq
MIRT1036596	hsa-miR-548ag	CLIP-seq
MIRT1036597	hsa-miR-548ai	CLIP-seq
MIRT1036598	hsa-miR-548aj	CLIP-seq
MIRT1036599	hsa-miR-548am	CLIP-seq
MIRT1036600	hsa-miR-548d-3p	CLIP-seq
MIRT1036601	hsa-miR-548x	CLIP-seq
MIRT1036602	hsa-miR-548z	CLIP-seq
MIRT1036603	hsa-miR-607	CLIP-seq
MIRT2007315	hsa-miR-2467-3p	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2007319	hsa-miR-3678-3p	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT2007321	hsa-miR-4267	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2007323	hsa-miR-4731-5p	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2388805	hsa-miR-1255a	CLIP-seq
MIRT2388806	hsa-miR-1255b	CLIP-seq
MIRT2388807	hsa-miR-15a	CLIP-seq
MIRT2388808	hsa-miR-15b	CLIP-seq
MIRT2388809	hsa-miR-16	CLIP-seq
MIRT2388810	hsa-miR-195	CLIP-seq
MIRT2388811	hsa-miR-214	CLIP-seq
MIRT2388812	hsa-miR-3619-5p	CLIP-seq
MIRT2388813	hsa-miR-424	CLIP-seq
MIRT2388814	hsa-miR-4433	CLIP-seq
MIRT2388815	hsa-miR-4459	CLIP-seq
MIRT2388816	hsa-miR-4768-3p	CLIP-seq
MIRT2388817	hsa-miR-4772-5p	CLIP-seq
MIRT2388818	hsa-miR-497	CLIP-seq
MIRT2388819	hsa-miR-761	CLIP-seq
MIRT2543587	hsa-miR-1252	CLIP-seq
MIRT2543588	hsa-miR-1264	CLIP-seq
MIRT2543589	hsa-miR-1302	CLIP-seq
MIRT2543590	hsa-miR-130a	CLIP-seq
MIRT2543591	hsa-miR-130b	CLIP-seq
MIRT2543592	hsa-miR-1909	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2543593	hsa-miR-2861	CLIP-seq
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT2543594	hsa-miR-301a	CLIP-seq
MIRT2543595	hsa-miR-301b	CLIP-seq
MIRT2543596	hsa-miR-3119	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2543597	hsa-miR-3155	CLIP-seq
MIRT2543598	hsa-miR-3155b	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2543599	hsa-miR-3202	CLIP-seq
MIRT2543600	hsa-miR-3591-5p	CLIP-seq
MIRT2543601	hsa-miR-3666	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT2543602	hsa-miR-3974	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT2543603	hsa-miR-4295	CLIP-seq
MIRT2543604	hsa-miR-4298	CLIP-seq
MIRT2543605	hsa-miR-4473	CLIP-seq
MIRT2543606	hsa-miR-4476	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT2543607	hsa-miR-4533	CLIP-seq
MIRT2543608	hsa-miR-454	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2543609	hsa-miR-4671-3p	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT2543610	hsa-miR-4727-3p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT2543611	hsa-miR-4747-5p	CLIP-seq
MIRT2543612	hsa-miR-484	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2543613	hsa-miR-493	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT2543614	hsa-miR-635	CLIP-seq
MIRT2682158	hsa-miR-1224-3p	CLIP-seq
MIRT2543587	hsa-miR-1252	CLIP-seq
MIRT2682159	hsa-miR-1260	CLIP-seq
MIRT2682160	hsa-miR-1260b	CLIP-seq
MIRT2543588	hsa-miR-1264	CLIP-seq
MIRT2682161	hsa-miR-1280	CLIP-seq
MIRT2543589	hsa-miR-1302	CLIP-seq
MIRT2543590	hsa-miR-130a	CLIP-seq
MIRT2543591	hsa-miR-130b	CLIP-seq
MIRT2682162	hsa-miR-151-5p	CLIP-seq
MIRT2682163	hsa-miR-151b	CLIP-seq
MIRT2682164	hsa-miR-1827	CLIP-seq
MIRT2543592	hsa-miR-1909	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2543593	hsa-miR-2861	CLIP-seq
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT2543594	hsa-miR-301a	CLIP-seq
MIRT2543595	hsa-miR-301b	CLIP-seq
MIRT2543596	hsa-miR-3119	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2543597	hsa-miR-3155	CLIP-seq
MIRT2543598	hsa-miR-3155b	CLIP-seq
MIRT2682165	hsa-miR-3176	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2543599	hsa-miR-3202	CLIP-seq
MIRT2543600	hsa-miR-3591-5p	CLIP-seq
MIRT2682166	hsa-miR-3612	CLIP-seq
MIRT2682167	hsa-miR-3665	CLIP-seq
MIRT2543601	hsa-miR-3666	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT2682168	hsa-miR-3922-3p	CLIP-seq
MIRT2682169	hsa-miR-3922-5p	CLIP-seq
MIRT2543602	hsa-miR-3974	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT2543603	hsa-miR-4295	CLIP-seq
MIRT2543604	hsa-miR-4298	CLIP-seq
MIRT2543605	hsa-miR-4473	CLIP-seq
MIRT2543606	hsa-miR-4476	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT2543607	hsa-miR-4533	CLIP-seq
MIRT2543608	hsa-miR-454	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2543609	hsa-miR-4671-3p	CLIP-seq
MIRT2682170	hsa-miR-4695-5p	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT2543610	hsa-miR-4727-3p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT2007323	hsa-miR-4731-5p	CLIP-seq
MIRT2682171	hsa-miR-4736	CLIP-seq
MIRT2543611	hsa-miR-4747-5p	CLIP-seq
MIRT2543612	hsa-miR-484	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2543613	hsa-miR-493	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT2543614	hsa-miR-635	CLIP-seq
MIRT2682172	hsa-miR-650	CLIP-seq
MIRT2682173	hsa-miR-764	CLIP-seq
MIRT2682174	hsa-miR-940	CLIP-seq

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	2034681, 8373352, 16549767
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005515	Function	Protein binding	IPI	24965446, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	2034681, 8373352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	2034681, 8373352, 16549767
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	17023043
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IDA	17023043, 22406107
GO:0014809	Process	Regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion	IDA	17023043
GO:0016529	Component	Sarcoplasmic reticulum	IDA	22406107
GO:0016740	Function	Transferase activity	IEA
GO:0018916	Process	Nitrobenzene metabolic process	IDA	2034681, 8373352
GO:0019855	Function	Calcium channel inhibitor activity	IDA	22406107
GO:0019899	Function	Enzyme binding	IPI	8373352
GO:0042178	Process	Xenobiotic catabolic process	IDA	2034681, 8373352, 16549767
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	8373352
GO:0043295	Function	Glutathione binding	IDA	2034681, 8373352
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0044325	Function	Transmembrane transporter binding	IPI	22406107
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0055119	Process	Relaxation of cardiac muscle	TAS	21323602
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070458	Process	Cellular detoxification of nitrogen compound	IDA	2034681, 8373352
GO:0071313	Process	Cellular response to caffeine	IDA	22406107
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
138380	4634	ENSG00000213366

P28161

Protein name

Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (GSTM2-2)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276). {ECO:0000269|PubMed:16549767, ECO:0000269|PubMed:21046276

PDB

1HNA , 1HNB , 1HNC , 1XW5 , 1YKC , 2AB6 , 2C4J , 2GTU , 3GTU , 3GUR , 5HWL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00043	GST_C	104 → 192	Glutathione S-transferase, C-terminal domain	Domain
PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Muscle.

Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Sequence length

218

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glutathione metabolism	Glutathione conjugation
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (14)
BREAST CANCER	—	GWAS catalog	29059683, 32424353	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683, 32424353, 35803233	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	19900515	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	11771762	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT URINARY SYSTEM NEOPLASM	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	16214533	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	15964507	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (169)
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	20623750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12492580, 23707957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22085405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34918636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18952980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	21212706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	8959321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11500195		★★★★★ ★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	24004509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12186820, 16882827, 23647087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11500195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	11680579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17476458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	18664505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	27104679		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	27104679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10022251, 11297759, 11825664, 12117698, 14643449, 15832776, 16005379, 16399374, 18690546, 21082260, 21558090, 24022663, 24075358, 24914957, 30539835, 31516386, 8033143, 8959320 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10862521, 11303592, 11810042, 12296511, 12556960, 12611461, 14973116, 15090724, 15344211, 16758119, 17624589, 18542066, 19856098, 19859803, 19936916 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26510686, 40508038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	18664505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	15928955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20165882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	29528252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10022251, 11297759, 11825664, 12117698, 14643449, 15832776, 16005379, 16399374, 21082260, 21558090, 23664103, 24022663, 24075358, 24914957, 30539835, 31516386, 8033143, 8959320 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	22296360, 22900055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10744127, 11062156, 11085692, 11588132, 12151353, 12781423, 12894585, 14553946, 14628089, 16642467, 19669596, 21791872, 23000285, 28427236, 7563171 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	40179422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10868693, 11949955, 19859803, 20966642, 23884605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12879272, 16973168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	17514530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22528457		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19012698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	18090121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	12969868, 19591959, 19860819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18952980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	27498857, 31340563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20954980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12010828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10639528, 15038404, 15218992, 19017460, 20402821, 22160572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	33978213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	12631536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	7614702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32539715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10769717, 11410321, 15932063, 16399374, 18473390, 18630481, 19124514, 20123161, 24197978, 26831664, 29516983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18630481, 27566576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10207633, 10633178, 15093278, 16949064, 21360194, 25395496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	25472599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10794492, 20083259, 24337975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12519635, 18583868, 18950733, 24525147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12519635, 18583868, 18950733, 24525147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12519635, 18583868, 18950733, 24525147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27540835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	15115915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	40508038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16390810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	10901185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	CTD_human_DG	11771762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome, Partial Trisomy 21	Down Syndrome	CTD_human_DG	11771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	8923609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11949955, 12875700, 15299090, 15861041, 20147336, 25549292, 26350109, 9358003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	12499585, 24970787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17203516, 23625656, 26855551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17203516, 26855551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	19782926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	16496253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27998724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	12873455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	11040079, 15864623, 16973661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23079710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	11740339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15195058, 16302194, 9659241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30032483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18551009, 21728793, 24788870, 25742618, 30420646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23787247, 30987408, 31689810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31694285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	BEFREE	12485442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	27498857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	20623750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	27498857, 31340563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	15334395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23725116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18287869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	10334189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10762000, 10889918, 21436184, 23801151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10051470, 10192309, 10408872, 15688397, 16132793, 16314088, 22994742, 23390017, 24852428, 24998552, 7557094, 8635154, 8659516, 9288607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16316639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15115915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21246532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27755947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	31680826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15195058, 16302194, 9659241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10862521, 11303592, 11810042, 12296511, 12556960, 12611461, 14973116, 15090724, 15344211, 16758119, 17624589, 18542066, 19856098, 19859803, 19936916 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17203516, 26855551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24136740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	11097350, 22296360, 22900055, 9456238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10744127, 11062156, 11085692, 11588132, 12151353, 12781423, 12894585, 14553946, 14628089, 16642467, 19669596, 21791872, 23000285, 28427236, 7563171 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10762000, 10889918, 21436184, 23801151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10868693, 19859803, 20966642, 23884605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11434510, 11552710, 16018936, 16173036, 16399374, 16921513, 19265530, 20599479, 23534760, 24961912, 27220660, 9861231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12767525, 15596296, 18779738, 21167396, 21839153, 22799358, 22952149, 24948179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12433731, 22765906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10022251, 11297759, 11825664, 12117698, 14643449, 15832776, 16005379, 16399374, 21082260, 21558090, 24022663, 24075358, 24914957, 30539835, 31516386, 8033143, 8959320 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10971208, 12579293, 12747973, 16638627, 24250808, 25399842, 25472599, 28340461, 9649243, 9659241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	7614702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18952980		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11352862, 19161404, 25588060, 27540835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	10759887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16052406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15901999, 19860557, 22576927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10744635, 23275234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10385146, 16235985, 18712965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11056682, 24961912, 29528252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	36939926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	9164836	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	15964507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31680826		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutrophilia (disorder)	Neutrophilia	BEFREE	23204253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18492019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11740339, 15038404, 25472599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	19900515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27998724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	29528252		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10868693, 19859803, 20966642, 23884605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	23647087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	9696930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	25378345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11688992, 12524158, 14732367, 15061826, 27078701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	17476458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	36939926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	30617052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	23707957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	8491405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11434510, 11552710, 16018936, 16173036, 16399374, 16921513, 19265530, 20599479, 23534760, 24961912, 27220660, 9861231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	23647087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26535568, 29067933, 31774007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	15273656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	9257159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	16977343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22686318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10794492, 20083259, 24337975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	24004509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11920399, 12879272, 15940757, 23053970, 28703442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11181039, 15318028, 26295386		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22874804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23287989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30696891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylo-ocular syndrome	Spondyloocular Syndrome	BEFREE	23287989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10489995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12419833, 20409775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25612142	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	17016589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19334053, 9659241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12172927, 12767525, 15596296, 18779738, 21167396, 21839153, 22799358, 22952149, 24948179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12433731, 22765906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12433731, 22765906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trisomy 21, Meiotic Nondisjunction	Trisomy 21	CTD_human_DG	11771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trisomy 21, Mitotic Nondisjunction	Trisomy 21	CTD_human_DG	11771762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31646988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35594716	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23159782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	11870126, 21488930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	24295891, 29641697		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	24295891, 29641697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30042310		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
GSTM4	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM5	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
MGST1	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTO1	2	["Degenerative disorder","Neurodegenerative disorder"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	3	["Disgenet (Degenerative disorder)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)"]
GSTM1	4	["Degenerative disorder","Kidney failure","Neurodegenerative disorder","Willis-ekbom disease"]	11	["Glutathione metabolism","Metabolism of xenobiotics by cytochrome P450","Drug metabolism - cytochrome P450","Drug metabolism - other enzymes","Platinum drug resistance","Chemical carcinogenesis - DNA adducts","Chemical carcinogenesis - receptor activation","Chemical carcinogenesis - reactive oxygen species","Hepatocellular carcinoma","Fluid shear stress and atherosclerosis","Glutathione conjugation"]	5	["Disgenet (Degenerative disorder)","Disgenet (Kidney failure)","CTD (Neurodegenerative disorder)","Disgenet (Neurodegenerative disorder)","GWAS catalog (Willis-ekbom disease)"]

GSTM2 (glutathione S-transferase mu 2)

Bookmark This Gene