Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	64223
Gene name	MTOR associated protein MLST8
Gene symbol	MLST8
Synonyms (NCBI Gene)	GBLGbetaLLST8POP3WAT1
Chromosome	16
Chromosome location	16p13.3

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052837	hsa-miR-4326	CLASH	23622248
MIRT2571688	hsa-miR-1261	CLIP-seq
MIRT2571689	hsa-miR-4488	CLIP-seq
MIRT2571690	hsa-miR-4656	CLIP-seq
MIRT2571691	hsa-miR-4697-5p	CLIP-seq
MIRT2571692	hsa-miR-4782-5p	CLIP-seq
MIRT2571693	hsa-miR-637	CLIP-seq
MIRT2571688	hsa-miR-1261	CLIP-seq
MIRT2685076	hsa-miR-1915	CLIP-seq
MIRT2685077	hsa-miR-214	CLIP-seq
MIRT2685078	hsa-miR-3136-3p	CLIP-seq
MIRT2685079	hsa-miR-3619-5p	CLIP-seq
MIRT2685080	hsa-miR-3922-5p	CLIP-seq
MIRT2685081	hsa-miR-4436b-3p	CLIP-seq
MIRT2571689	hsa-miR-4488	CLIP-seq
MIRT2685082	hsa-miR-4529-5p	CLIP-seq
MIRT2685083	hsa-miR-4530	CLIP-seq
MIRT2571690	hsa-miR-4656	CLIP-seq
MIRT2685084	hsa-miR-4685-5p	CLIP-seq
MIRT2685085	hsa-miR-4693-3p	CLIP-seq
MIRT2571691	hsa-miR-4697-5p	CLIP-seq
MIRT2685086	hsa-miR-4726-3p	CLIP-seq
MIRT2571692	hsa-miR-4782-5p	CLIP-seq
MIRT2685087	hsa-miR-524-3p	CLIP-seq
MIRT2685088	hsa-miR-525-3p	CLIP-seq
MIRT2571693	hsa-miR-637	CLIP-seq
MIRT2685089	hsa-miR-761	CLIP-seq

42 Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12408816, 17461779, 20562859, 23636326, 24036451, 26348909, 26678875, 29750193, 30232230, 33961781, 35561222
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006974	Process	DNA damage response	NAS	17041623
GO:0007010	Process	Cytoskeleton organization	NAS	15268862
GO:0010507	Process	Negative regulation of autophagy	NAS	28283069
GO:0016020	Component	Membrane	IEA
GO:0030307	Process	Positive regulation of cell growth	NAS	22500797, 25906254
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	31085701
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0031669	Process	Cellular response to nutrient levels	NAS	19299511, 22500797
GO:0031929	Process	TOR signaling	IBA
GO:0031929	Process	TOR signaling	IEA
GO:0031931	Component	TORC1 complex	IBA
GO:0031931	Component	TORC1 complex	IDA	12718876, 24036451, 26678875, 27909983, 28489822, 29236692, 31601764
GO:0031931	Component	TORC1 complex	IEA
GO:0031931	Component	TORC1 complex	IPI	26678875
GO:0031932	Component	TORC2 complex	IBA
GO:0031932	Component	TORC2 complex	IDA	24036451, 28489822, 29424687, 29567957, 31085701, 33158864, 35926713
GO:0031932	Component	TORC2 complex	IEA
GO:0031932	Component	TORC2 complex	IPI	17461779
GO:0032008	Process	Positive regulation of TOR signaling	IMP	15467718
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	15467718
GO:0038202	Process	TORC1 signaling	IDA	28489822
GO:0038202	Process	TORC1 signaling	IMP	12718876
GO:0038203	Process	TORC2 signaling	IDA	28264193
GO:0038203	Process	TORC2 signaling	IDA	28489822, 29424687, 29567957, 31085701, 33158864, 35926713
GO:0043066	Process	Negative regulation of apoptotic process	NAS	22500797
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	28147277
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	12718876
GO:0045821	Process	Positive regulation of glycolytic process	NAS	20670887
GO:0046889	Process	Positive regulation of lipid biosynthetic process	NAS	20670887
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	9094314
GO:0071456	Process	Cellular response to hypoxia	NAS	17041623
GO:0071470	Process	Cellular response to osmotic stress	NAS	17041623
GO:1902554	Component	Serine/threonine protein kinase complex	IDA	26678875, 35926713
GO:1905857	Process	Positive regulation of pentose-phosphate shunt	NAS	20670887

MIM	HGNC	e!Ensembl
612190	24825	ENSG00000167965

Q9BVC4

Protein name

Target of rapamycin complex subunit LST8 (TORC subunit LST8) (G protein beta subunit-like) (Gable) (Protein GbetaL) (Mammalian lethal with SEC13 protein 8) (mLST8)

Protein function

Subunit of both mTORC1 and mTORC2, which regulates cell growth and survival in response to nutrient and hormonal signals (PubMed:12718876, PubMed:15268862, PubMed:15467718, PubMed:24403073, PubMed:28489822). mTORC1 is activated in response to gr

PDB

4JSN , 4JSP , 4JSV , 4JSX , 4JT5 , 4JT6 , 5FLC , 5H64 , 5WBU , 5WBY , 5ZCS , 6BCU , 6BCX , 6SB0 , 6SB2 , 6ZWM , 6ZWO , 7OWG , 7PE7 , 7PE8 , 7PE9 , 7PEA , 7PEB , 7PEC , 7TZO , 7UXC , 7UXH , 8ERA , 8RCH , 8RCK , 9F44 , 9F45

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	209 → 248	WD domain, G-beta repeat	Repeat
PF00400	WD40	75 → 113	WD domain, G-beta repeat	Repeat
PF00400	WD40	119 → 156	WD domain, G-beta repeat	Repeat
PF00400	WD40	256 → 298	WD domain, G-beta repeat	Repeat
PF00400	WD40	32 → 69	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Broadly expressed, with highest levels in skeletal muscle, heart and kidney. {ECO:0000269|PubMed:12408816}.

Sequence

MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDP
DASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSGNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG

Sequence length

326

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Autophagy - other	PIP3 activates AKT signaling
Autophagy - animal	Macroautophagy
mTOR signaling pathway	mTOR signalling
PI3K-Akt signaling pathway	mTORC1-mediated signalling
Thermogenesis	HSF1-dependent transactivation
	Energy dependent regulation of mTOR by LKB1-AMPK
	CD28 dependent PI3K/Akt signaling
	VEGFR2 mediated vascular permeability
	TP53 Regulates Metabolic Genes
	Constitutive Signaling by AKT1 E17K in Cancer
	Regulation of TP53 Degradation
	Regulation of PTEN gene transcription
	Amino acids regulate mTORC1

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
RPTOR	[]	12	["Autophagy - other","Autophagy - animal","mTOR signaling pathway","Thermogenesis","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK","HSF1-dependent transactivation"]	[]
RRAGB	[]	9	["Autophagy - animal","mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
RRAGD	[]	9	["Autophagy - animal","mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
RRAGC	[]	9	["Autophagy - animal","mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]
RRAGA	[]	9	["Autophagy - animal","mTOR signaling pathway","TP53 Regulates Metabolic Genes","Macroautophagy","Regulation of PTEN gene transcription","Amino acids regulate mTORC1","mTOR signalling","mTORC1-mediated signalling","Energy dependent regulation of mTOR by LKB1-AMPK"]	[]

MLST8 (MTOR associated protein MLST8)

Bookmark This Gene