INO80 (INO80 complex ATPase subunit)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54617
• Gene name: INO80 complex ATPase subunit
• Gene symbol: INO80
• Synonyms (NCBI Gene): INO80A, INOC1
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: This gene encodes a subunit of the chromatin remodeling complex, which is classified into subfamilies depending on sequence features apart from the conserved ATPase domain. This protein is the catalytic ATPase subunit of the INO80 chromatin remodeling com

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs199722402	C>T	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs730882226	A>G	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant, genic upstream transcript variant

miRNA Show/Hide all (393)

miRTarBase ID	miRNA	Experiments	Reference
MIRT632816	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT632815	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632814	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632813	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT673262	hsa-miR-5693	HITS-CLIP	23824327
MIRT632812	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632811	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT632810	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT673254	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT632809	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT632808	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632807	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632806	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT632805	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT673248	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT632804	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT632803	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT673245	hsa-miR-5698	HITS-CLIP	23824327
MIRT632816	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT632815	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632814	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632813	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT673262	hsa-miR-5693	HITS-CLIP	23824327
MIRT673261	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT673260	hsa-miR-4532	HITS-CLIP	23824327
MIRT673259	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT673258	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT673257	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT632812	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632811	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT673256	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT673255	hsa-miR-1976	HITS-CLIP	23824327
MIRT632810	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT673254	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT632809	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT632808	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632807	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632806	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT673253	hsa-miR-3135b	HITS-CLIP	23824327
MIRT673252	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT673251	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT632805	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT673250	hsa-miR-3652	HITS-CLIP	23824327
MIRT673249	hsa-miR-4430	HITS-CLIP	23824327
MIRT673248	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT673247	hsa-miR-1206	HITS-CLIP	23824327
MIRT673246	hsa-miR-4279	HITS-CLIP	23824327
MIRT632804	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT632803	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT673245	hsa-miR-5698	HITS-CLIP	23824327
MIRT632816	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT632815	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632814	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632813	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT632812	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632811	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT632810	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT632809	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT632808	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632807	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632806	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT632805	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT632804	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT632803	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT727447	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727445	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT632816	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT632815	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632814	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632813	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT673262	hsa-miR-5693	HITS-CLIP	23824327
MIRT632812	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632811	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT632810	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT673254	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT632809	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT632808	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632807	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632806	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT632805	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT673248	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT632804	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT632803	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT673245	hsa-miR-5698	HITS-CLIP	23824327
MIRT632816	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT632815	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632814	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632813	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT673262	hsa-miR-5693	HITS-CLIP	23824327
MIRT673261	hsa-miR-1247-3p	HITS-CLIP	23824327
MIRT673260	hsa-miR-4532	HITS-CLIP	23824327
MIRT673259	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT673258	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT673257	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT632812	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632811	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT673256	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT673255	hsa-miR-1976	HITS-CLIP	23824327
MIRT632810	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT673254	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT632809	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT632808	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632807	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632806	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT673253	hsa-miR-3135b	HITS-CLIP	23824327
MIRT673252	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT673251	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT632805	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT673250	hsa-miR-3652	HITS-CLIP	23824327
MIRT673249	hsa-miR-4430	HITS-CLIP	23824327
MIRT673248	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT673247	hsa-miR-1206	HITS-CLIP	23824327
MIRT673246	hsa-miR-4279	HITS-CLIP	23824327
MIRT632804	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT632803	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT673245	hsa-miR-5698	HITS-CLIP	23824327
MIRT632816	hsa-miR-6796-3p	HITS-CLIP	23824327
MIRT632815	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632814	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632813	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT632812	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632811	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT632810	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT632809	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT632808	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632807	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632806	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT632805	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT632804	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT632803	hsa-miR-6836-3p	HITS-CLIP	23824327
MIRT1066719	hsa-miR-106a	CLIP-seq
MIRT1066720	hsa-miR-106b	CLIP-seq
MIRT1066721	hsa-miR-1178	CLIP-seq
MIRT1066722	hsa-miR-1207-5p	CLIP-seq
MIRT1066723	hsa-miR-1228	CLIP-seq
MIRT1066724	hsa-miR-1251	CLIP-seq
MIRT1066725	hsa-miR-1252	CLIP-seq
MIRT1066726	hsa-miR-125a-3p	CLIP-seq
MIRT1066727	hsa-miR-1287	CLIP-seq
MIRT1066728	hsa-miR-129-3p	CLIP-seq
MIRT1066729	hsa-miR-145	CLIP-seq
MIRT1066730	hsa-miR-148a	CLIP-seq
MIRT1066731	hsa-miR-148b	CLIP-seq
MIRT1066732	hsa-miR-152	CLIP-seq
MIRT1066733	hsa-miR-17	CLIP-seq
MIRT1066734	hsa-miR-19a	CLIP-seq
MIRT1066735	hsa-miR-19b	CLIP-seq
MIRT1066736	hsa-miR-20a	CLIP-seq
MIRT1066737	hsa-miR-20b	CLIP-seq
MIRT1066738	hsa-miR-2276	CLIP-seq
MIRT1066739	hsa-miR-2392	CLIP-seq
MIRT1066740	hsa-miR-2467-5p	CLIP-seq
MIRT1066741	hsa-miR-300	CLIP-seq
MIRT1066742	hsa-miR-302a	CLIP-seq
MIRT1066743	hsa-miR-302b	CLIP-seq
MIRT1066744	hsa-miR-302c	CLIP-seq
MIRT1066745	hsa-miR-302d	CLIP-seq
MIRT1066746	hsa-miR-302e	CLIP-seq
MIRT1066747	hsa-miR-3184	CLIP-seq
MIRT1066748	hsa-miR-3188	CLIP-seq
MIRT1066749	hsa-miR-331-3p	CLIP-seq
MIRT1066750	hsa-miR-342-3p	CLIP-seq
MIRT1066751	hsa-miR-34a	CLIP-seq
MIRT1066752	hsa-miR-34c-5p	CLIP-seq
MIRT1066753	hsa-miR-3658	CLIP-seq
MIRT1066754	hsa-miR-3667-3p	CLIP-seq
MIRT1066755	hsa-miR-3692	CLIP-seq
MIRT1066756	hsa-miR-370	CLIP-seq
MIRT1066757	hsa-miR-372	CLIP-seq
MIRT1066758	hsa-miR-373	CLIP-seq
MIRT1066759	hsa-miR-381	CLIP-seq
MIRT1066760	hsa-miR-3913-3p	CLIP-seq
MIRT1066761	hsa-miR-3934	CLIP-seq
MIRT1066762	hsa-miR-3975	CLIP-seq
MIRT1066763	hsa-miR-423-5p	CLIP-seq
MIRT1066764	hsa-miR-4257	CLIP-seq
MIRT1066765	hsa-miR-4268	CLIP-seq
MIRT1066766	hsa-miR-4269	CLIP-seq
MIRT1066767	hsa-miR-4287	CLIP-seq
MIRT1066768	hsa-miR-4316	CLIP-seq
MIRT1066769	hsa-miR-4436a	CLIP-seq
MIRT1066770	hsa-miR-4448	CLIP-seq
MIRT1066771	hsa-miR-4469	CLIP-seq
MIRT1066772	hsa-miR-449a	CLIP-seq
MIRT1066773	hsa-miR-449b	CLIP-seq
MIRT1066774	hsa-miR-4502	CLIP-seq
MIRT1066775	hsa-miR-4514	CLIP-seq
MIRT1066776	hsa-miR-4522	CLIP-seq
MIRT1066777	hsa-miR-4638-3p	CLIP-seq
MIRT1066778	hsa-miR-4652-5p	CLIP-seq
MIRT1066779	hsa-miR-4661-5p	CLIP-seq
MIRT1066780	hsa-miR-4666-3p	CLIP-seq
MIRT1066781	hsa-miR-4685-3p	CLIP-seq
MIRT1066782	hsa-miR-4687-5p	CLIP-seq
MIRT1066783	hsa-miR-4688	CLIP-seq
MIRT1066784	hsa-miR-4692	CLIP-seq
MIRT1066785	hsa-miR-4696	CLIP-seq
MIRT1066786	hsa-miR-4707-3p	CLIP-seq
MIRT1066787	hsa-miR-4733-3p	CLIP-seq
MIRT1066788	hsa-miR-4736	CLIP-seq
MIRT1066789	hsa-miR-4742-5p	CLIP-seq
MIRT1066790	hsa-miR-4763-3p	CLIP-seq
MIRT1066791	hsa-miR-4772-3p	CLIP-seq
MIRT1066792	hsa-miR-485-5p	CLIP-seq
MIRT1066793	hsa-miR-486-3p	CLIP-seq
MIRT1066794	hsa-miR-519d	CLIP-seq
MIRT1066795	hsa-miR-520a-3p	CLIP-seq
MIRT1066796	hsa-miR-520b	CLIP-seq
MIRT1066797	hsa-miR-520c-3p	CLIP-seq
MIRT1066798	hsa-miR-520d-3p	CLIP-seq
MIRT1066799	hsa-miR-520e	CLIP-seq
MIRT1066800	hsa-miR-548n	CLIP-seq
MIRT1066801	hsa-miR-548t	CLIP-seq
MIRT1066802	hsa-miR-563	CLIP-seq
MIRT1066803	hsa-miR-659	CLIP-seq
MIRT1066804	hsa-miR-764	CLIP-seq
MIRT1066805	hsa-miR-93	CLIP-seq
MIRT1066806	hsa-miR-937	CLIP-seq
MIRT1066807	hsa-miR-940	CLIP-seq
MIRT2016001	hsa-miR-1292	CLIP-seq
MIRT1066728	hsa-miR-129-3p	CLIP-seq
MIRT1066729	hsa-miR-145	CLIP-seq
MIRT2016002	hsa-miR-1913	CLIP-seq
MIRT2016003	hsa-miR-22	CLIP-seq
MIRT2016004	hsa-miR-2964a-3p	CLIP-seq
MIRT2016005	hsa-miR-302f	CLIP-seq
MIRT2016006	hsa-miR-3117-5p	CLIP-seq
MIRT2016007	hsa-miR-3120-5p	CLIP-seq
MIRT2016008	hsa-miR-3138	CLIP-seq
MIRT2016009	hsa-miR-3150a-3p	CLIP-seq
MIRT2016010	hsa-miR-3170	CLIP-seq
MIRT2016011	hsa-miR-3175	CLIP-seq
MIRT2016012	hsa-miR-3192	CLIP-seq
MIRT2016013	hsa-miR-324-3p	CLIP-seq
MIRT2016014	hsa-miR-326	CLIP-seq
MIRT2016015	hsa-miR-330-5p	CLIP-seq
MIRT2016016	hsa-miR-3661	CLIP-seq
MIRT2016017	hsa-miR-3919	CLIP-seq
MIRT1066767	hsa-miR-4287	CLIP-seq
MIRT2016018	hsa-miR-4300	CLIP-seq
MIRT2016019	hsa-miR-4318	CLIP-seq
MIRT1066771	hsa-miR-4469	CLIP-seq
MIRT2016020	hsa-miR-4471	CLIP-seq
MIRT2016021	hsa-miR-4646-5p	CLIP-seq
MIRT1066779	hsa-miR-4661-5p	CLIP-seq
MIRT2016022	hsa-miR-4667-5p	CLIP-seq
MIRT2016023	hsa-miR-4684-5p	CLIP-seq
MIRT1066781	hsa-miR-4685-3p	CLIP-seq
MIRT1066782	hsa-miR-4687-5p	CLIP-seq
MIRT2016024	hsa-miR-4700-5p	CLIP-seq
MIRT2016025	hsa-miR-4711-3p	CLIP-seq
MIRT2016026	hsa-miR-4712-3p	CLIP-seq
MIRT2016027	hsa-miR-4731-5p	CLIP-seq
MIRT2016028	hsa-miR-4749-3p	CLIP-seq
MIRT2016029	hsa-miR-4753-3p	CLIP-seq
MIRT2016030	hsa-miR-4756-3p	CLIP-seq
MIRT2016031	hsa-miR-4789-5p	CLIP-seq
MIRT2016032	hsa-miR-4800-5p	CLIP-seq
MIRT2016033	hsa-miR-483-3p	CLIP-seq
MIRT2016034	hsa-miR-539	CLIP-seq
MIRT2016035	hsa-miR-558	CLIP-seq
MIRT2016036	hsa-miR-576-3p	CLIP-seq
MIRT2016037	hsa-miR-593	CLIP-seq
MIRT2016038	hsa-miR-631	CLIP-seq
MIRT2016039	hsa-miR-637	CLIP-seq
MIRT2016040	hsa-miR-769-5p	CLIP-seq
MIRT2016041	hsa-miR-920	CLIP-seq
MIRT2016042	hsa-miR-939	CLIP-seq
MIRT2248486	hsa-miR-1243	CLIP-seq
MIRT1066724	hsa-miR-1251	CLIP-seq
MIRT1066726	hsa-miR-125a-3p	CLIP-seq
MIRT2248487	hsa-miR-1284	CLIP-seq
MIRT1066728	hsa-miR-129-3p	CLIP-seq
MIRT1066730	hsa-miR-148a	CLIP-seq
MIRT1066731	hsa-miR-148b	CLIP-seq
MIRT1066732	hsa-miR-152	CLIP-seq
MIRT2248488	hsa-miR-1909	CLIP-seq
MIRT1066734	hsa-miR-19a	CLIP-seq
MIRT1066735	hsa-miR-19b	CLIP-seq
MIRT2016003	hsa-miR-22	CLIP-seq
MIRT1066741	hsa-miR-300	CLIP-seq
MIRT2016006	hsa-miR-3117-5p	CLIP-seq
MIRT2016007	hsa-miR-3120-5p	CLIP-seq
MIRT2016008	hsa-miR-3138	CLIP-seq
MIRT2016009	hsa-miR-3150a-3p	CLIP-seq
MIRT2248489	hsa-miR-3151	CLIP-seq
MIRT2016010	hsa-miR-3170	CLIP-seq
MIRT2016011	hsa-miR-3175	CLIP-seq
MIRT1066748	hsa-miR-3188	CLIP-seq
MIRT2248490	hsa-miR-3199	CLIP-seq
MIRT2016014	hsa-miR-326	CLIP-seq
MIRT2016015	hsa-miR-330-5p	CLIP-seq
MIRT2248491	hsa-miR-3616-3p	CLIP-seq
MIRT2248492	hsa-miR-3654	CLIP-seq
MIRT1066753	hsa-miR-3658	CLIP-seq
MIRT2016016	hsa-miR-3661	CLIP-seq
MIRT1066754	hsa-miR-3667-3p	CLIP-seq
MIRT1066756	hsa-miR-370	CLIP-seq
MIRT1066759	hsa-miR-381	CLIP-seq
MIRT1066760	hsa-miR-3913-3p	CLIP-seq
MIRT2016017	hsa-miR-3919	CLIP-seq
MIRT1066761	hsa-miR-3934	CLIP-seq
MIRT1066764	hsa-miR-4257	CLIP-seq
MIRT2248493	hsa-miR-4283	CLIP-seq
MIRT2016018	hsa-miR-4300	CLIP-seq
MIRT2016019	hsa-miR-4318	CLIP-seq
MIRT2248494	hsa-miR-4436b-3p	CLIP-seq
MIRT2248495	hsa-miR-4489	CLIP-seq
MIRT1066778	hsa-miR-4652-5p	CLIP-seq
MIRT2248496	hsa-miR-4656	CLIP-seq
MIRT1066780	hsa-miR-4666-3p	CLIP-seq
MIRT2016022	hsa-miR-4667-5p	CLIP-seq
MIRT2016023	hsa-miR-4684-5p	CLIP-seq
MIRT1066782	hsa-miR-4687-5p	CLIP-seq
MIRT2016024	hsa-miR-4700-5p	CLIP-seq
MIRT1066786	hsa-miR-4707-3p	CLIP-seq
MIRT2248497	hsa-miR-4708-5p	CLIP-seq
MIRT2248498	hsa-miR-4740-5p	CLIP-seq
MIRT2016028	hsa-miR-4749-3p	CLIP-seq
MIRT2016030	hsa-miR-4756-3p	CLIP-seq
MIRT2016032	hsa-miR-4800-5p	CLIP-seq
MIRT2248499	hsa-miR-548c-3p	CLIP-seq
MIRT2016035	hsa-miR-558	CLIP-seq
MIRT2248500	hsa-miR-582-5p	CLIP-seq
MIRT2016037	hsa-miR-593	CLIP-seq
MIRT2016038	hsa-miR-631	CLIP-seq
MIRT2016039	hsa-miR-637	CLIP-seq
MIRT2248501	hsa-miR-640	CLIP-seq
MIRT1066804	hsa-miR-764	CLIP-seq
MIRT2016040	hsa-miR-769-5p	CLIP-seq
MIRT2016041	hsa-miR-920	CLIP-seq
MIRT1066806	hsa-miR-937	CLIP-seq
MIRT2016042	hsa-miR-939	CLIP-seq
MIRT2016003	hsa-miR-22	CLIP-seq
MIRT2016008	hsa-miR-3138	CLIP-seq
MIRT2016019	hsa-miR-4318	CLIP-seq
MIRT2016032	hsa-miR-4800-5p	CLIP-seq
MIRT2016035	hsa-miR-558	CLIP-seq
MIRT1066728	hsa-miR-129-3p	CLIP-seq
MIRT2016003	hsa-miR-22	CLIP-seq
MIRT1066741	hsa-miR-300	CLIP-seq
MIRT2016006	hsa-miR-3117-5p	CLIP-seq
MIRT2016008	hsa-miR-3138	CLIP-seq
MIRT2016009	hsa-miR-3150a-3p	CLIP-seq
MIRT2016010	hsa-miR-3170	CLIP-seq
MIRT2016011	hsa-miR-3175	CLIP-seq
MIRT2016014	hsa-miR-326	CLIP-seq
MIRT2016015	hsa-miR-330-5p	CLIP-seq
MIRT2016016	hsa-miR-3661	CLIP-seq
MIRT1066759	hsa-miR-381	CLIP-seq
MIRT2016017	hsa-miR-3919	CLIP-seq
MIRT1066767	hsa-miR-4287	CLIP-seq
MIRT2016018	hsa-miR-4300	CLIP-seq
MIRT2016019	hsa-miR-4318	CLIP-seq
MIRT1066771	hsa-miR-4469	CLIP-seq
MIRT1066779	hsa-miR-4661-5p	CLIP-seq
MIRT1066780	hsa-miR-4666-3p	CLIP-seq
MIRT2016022	hsa-miR-4667-5p	CLIP-seq
MIRT1066781	hsa-miR-4685-3p	CLIP-seq
MIRT1066782	hsa-miR-4687-5p	CLIP-seq
MIRT2016024	hsa-miR-4700-5p	CLIP-seq
MIRT2016026	hsa-miR-4712-3p	CLIP-seq
MIRT2016030	hsa-miR-4756-3p	CLIP-seq
MIRT2016032	hsa-miR-4800-5p	CLIP-seq
MIRT2016034	hsa-miR-539	CLIP-seq
MIRT2016035	hsa-miR-558	CLIP-seq
MIRT2016038	hsa-miR-631	CLIP-seq
MIRT2016039	hsa-miR-637	CLIP-seq
MIRT2016040	hsa-miR-769-5p	CLIP-seq
MIRT2016041	hsa-miR-920	CLIP-seq
MIRT2016042	hsa-miR-939	CLIP-seq
MIRT2016003	hsa-miR-22	CLIP-seq
MIRT2016006	hsa-miR-3117-5p	CLIP-seq
MIRT2016008	hsa-miR-3138	CLIP-seq
MIRT2016009	hsa-miR-3150a-3p	CLIP-seq
MIRT2016010	hsa-miR-3170	CLIP-seq
MIRT2016011	hsa-miR-3175	CLIP-seq
MIRT2016014	hsa-miR-326	CLIP-seq
MIRT2016015	hsa-miR-330-5p	CLIP-seq
MIRT2016016	hsa-miR-3661	CLIP-seq
MIRT2016017	hsa-miR-3919	CLIP-seq
MIRT2016018	hsa-miR-4300	CLIP-seq
MIRT2016019	hsa-miR-4318	CLIP-seq
MIRT2016022	hsa-miR-4667-5p	CLIP-seq
MIRT2016024	hsa-miR-4700-5p	CLIP-seq
MIRT2016030	hsa-miR-4756-3p	CLIP-seq
MIRT2016032	hsa-miR-4800-5p	CLIP-seq
MIRT2016035	hsa-miR-558	CLIP-seq
MIRT2016038	hsa-miR-631	CLIP-seq
MIRT2016039	hsa-miR-637	CLIP-seq
MIRT2016040	hsa-miR-769-5p	CLIP-seq
MIRT2016041	hsa-miR-920	CLIP-seq
MIRT2016042	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
YY1	Unknown	17721549

Gene ontology (GO) Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IMP	20237820
GO:0000166	Function	Nucleotide binding	IEA
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	ISO
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	18026119
GO:0003677	Function	DNA binding	IDA	16298340
GO:0003677	Function	DNA binding	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	18026119, 19014934, 20855601, 24981860, 26496610, 27705803, 29643506, 32296183, 33961781, 35140242, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16298340, 18026119
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006302	Process	Double-strand break repair	IMP	20687897
GO:0006310	Process	DNA recombination	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	ISS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	16298340
GO:0010571	Process	Positive regulation of nuclear cell cycle DNA replication	IMP	20237820
GO:0016604	Component	Nuclear body	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	20237820
GO:0031011	Component	Ino80 complex	IBA
GO:0031011	Component	Ino80 complex	IDA	18026119, 21303910
GO:0031011	Component	Ino80 complex	IEA
GO:0033044	Process	Regulation of chromosome organization	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0034644	Process	Cellular response to UV	IMP	18026119
GO:0042393	Function	Histone binding	IBA
GO:0043014	Function	Alpha-tubulin binding	IMP	20237820
GO:0045739	Process	Positive regulation of DNA repair	IEA
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20687897
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051054	Process	Positive regulation of DNA metabolic process	IEA
GO:0051225	Process	Spindle assembly	IMP	20237820
GO:0051276	Process	Chromosome organization	IEA
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:0070914	Process	UV-damage excision repair	IMP	20855601
GO:0071479	Process	Cellular response to ionizing radiation	IMP	20687897
GO:0140658	Function	ATP-dependent chromatin remodeler activity	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	IEA
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IMP	20237820

Other IDs

• MIM: 610169
• HGNC: 26956
• e!Ensembl: ENSG00000128908

Protein

• UniProt ID: Q9ULG1
• Protein name: Chromatin-remodeling ATPase INO80 (hINO80) (EC 3.6.4.-) (DNA helicase-related INO80 complex homolog 1) (DNA helicase-related protein INO80) (INO80 complex subunit A)
• Protein function: ATPase component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and DNA repair (PubMed:16230350, PubMed:16298340, PubMed:17721549, PubMed:20237820, PubMed:20855601). Binds DNA (PubMed:1
• PDB: 6HTS , 7ZI4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00176	SNF2_N	473 → 822	SNF2 family N-terminal domain	Family
  PF00271	Helicase_C	1101 → 1214	Helicase conserved C-terminal domain	Family
  PF13892	DBINO	273 → 405	DNA-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: According to PubMed:10574462, widely expressed. According to PubMed:16298340, specifically expressed in brain, liver and pancreas. {ECO:0000269|PubMed:10574462, ECO:0000269|PubMed:16298340}.
• Sequence:

  MASELGARDDGGCTELAKPLYLQYLERALRLDHFLRQTSAIFNRNISSDDSEDGLDDSNP
  LLPQSGDPLIQVKEEPPNSLLGETSGAGSSGMLNTYSLNGVLQSESKCDKGNLYNFSKLK
  KSRKWLKSILLSDESSEADSQSEDDDEEELNLSREELHNMLRLHKYKKLHQNKYSKDKEL
  QQYQYYSAGLLSTYDPFYEQQRHLLGPKKKKFKEEKKLKAKLKKVKKKRRRDEELSSEES
  PRRHHHQTKVFAKFSHDAPPPGTKKKHLSIEQLNARRRKVWLSIVKKELPKANKQKASAR
  NLFLTNSRKLAHQCMKEVRRAALQAQKNCKETLPRARRLTKEMLLYWKKYEKVEKEHRKR
  AEKEALEQRKLDEEMREAKRQQRKLNFLITQTELYAHFMSRKRDMGHDGIQEEILRKLED
  SSTQRQIDIGGGVVVNITQEDYDSNHFKAQALKNAENAYHIHQARTRSFDEDAKESRAAA
  LRAANKSGTGFGESYSLANPSIRAGEDIPQPTIFNGKLKGYQLKGMNWLANLYEQGINGI
  LADEMGLGKTVQSIALLAHLAERENIWGPFLIISPASTLNNWHQEFTRFVPKFKVLPYWG
  NPHDRKVIRRFWSQKTLYTQDAPFHVVITSYQLVVQDVKYFQRVKWQYMVLDEAQALKSS
  SSVRWKILLQFQCRNRLLLTGTPIQNTMAELWALLHFIMPTLFDSHEEFNEWFSKDIESH
  AENKSAIDENQLSRLHMILKPFMLRRIKKDVENELSDKIEILMYCQLTSRQKLLYQALKN
  KISIEDLLQSSMGSTQQAQNTTSSLMNLVMQFRKVCNHPELFERQETWSPFHISLKPYHI
  SKFIYRHGQIRVFNHSRDRWLRVLSPFAPDYIQRSLFHRKGINEESCFSFLRFIDISPAE
  MANLMLQGLLARWLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFP
  NLCSCPLLKSLVFSSHCKAVSGYSDQVVHQRRSATSSLRRCLLTELPSFLCVASPRVTAV
  PLDSYCNDRSAEYERRVLKEGGSLAAKQCLLNGAPELAADWLNRRSQFFPEPAGGLWSIR
  PQNGWSFIRIPGKESLITDSGKLYALDVLLTRLKSQGHRVLIYSQMTRMIDLLEEYMVYR
  KHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNP
  TVDQQAMDRAHRLGQTKQVTVYRLICKGTIEERILQRAKEKSEIQRMVISGGNFKPDTLK
  PKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRK
  EGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDM
  LVIVDDPASSAPQSRATNSPASITGSVSDTVNGISIQEMPAAGRGHSARSRGRPKGSGST
  AKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA
  GLADFGPSSASSPLSSPLSKGNNVPGNPKNLHMTSSLAPDSLVRKQGKGTNPSGGR

• Sequence length: 1556

Pathways

KEGG Pathway	Reactome Pathway
ATP-dependent chromatin remodeling	UCH proteinases
	DNA Damage Recognition in GG-NER

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
INO80-related immunodeficiency	Likely pathogenic	rs199722402, rs730882226	RCV005252782 RCV005252783	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Likely pathogenic	rs199722402, rs730882226	RCV000162143 RCV000162144	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary microcephaly	Likely pathogenic	rs199722402, rs730882226	RCV000162143 RCV000162144	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Seizure	Likely pathogenic	rs199722402, rs730882226	RCV000162143 RCV000162144	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
COMBINED IMMUNODEFICIENCY WITH GRANULOMATOSIS	—	Disgenet, Orphanet Disgenet, Orphanet	25312759	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MICROCEPHALY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778, 35915156, 41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	37947095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INO80-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (19)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	27779717		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27750218		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27750218		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASDB_DG	22479191		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29383140		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26489677		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	29371594		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33083497	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	30230192		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27641337		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27750218		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29383140		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27340176		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27340176, 27641337, 27779717, 29383140		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27641337		★☆☆☆☆ Found in Text Mining only
Primary microcephaly	Microcephaly	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32913330	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	29561707	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

INO80C 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. INO80E 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. TFPT 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. NFRKB 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER. INO80D 3 shared pathwaysATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER, UCH proteinases Related via 3 shared pathways including ATP-dependent chromatin remodeling, DNA Damage Recognition in GG-NER.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
INO80C	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
INO80E	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
TFPT	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
NFRKB	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]
INO80D	0	[]	3	["ATP-dependent chromatin remodeling","DNA Damage Recognition in GG-NER","UCH proteinases"]	0	[]

Diseases Linked via Similar Genes

Obesity Linked via 2 of 5 related genesTFPT, INO80D Color vision deficiency Linked via 1 of 5 related genesINO80C Eosinophilia Linked via 1 of 5 related genesINO80C Retinitis pigmentosa Linked via 1 of 5 related genesTFPT Alzheimer disease Linked via 1 of 5 related genesINO80D

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obesity	2	["TFPT","INO80D"]
Color vision deficiency	1	["INO80C"]
Eosinophilia	1	["INO80C"]
Retinitis pigmentosa	1	["TFPT"]
Alzheimer disease	1	["INO80D"]