Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	283899
Gene name	INO80 complex subunit E
Gene symbol	INO80E
Synonyms (NCBI Gene)	CCDC95
Chromosome	16
Chromosome location	16p11.2

76 Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT486122	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT486121	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT486119	hsa-miR-3195	PAR-CLIP	23592263
MIRT486120	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT486118	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT486117	hsa-miR-663a	PAR-CLIP	23592263
MIRT486116	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT486115	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT486114	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT486113	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT486112	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT486111	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT486110	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT486109	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT486108	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT486122	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT486121	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT486119	hsa-miR-3195	PAR-CLIP	23592263
MIRT486120	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT486118	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT486117	hsa-miR-663a	PAR-CLIP	23592263
MIRT486116	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT486115	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT486114	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT486113	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT486112	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT486111	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT486110	hsa-miR-128-1-5p	PAR-CLIP	23592263
MIRT486109	hsa-miR-128-2-5p	PAR-CLIP	23592263
MIRT486108	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT1067103	hsa-miR-1908	CLIP-seq
MIRT1067104	hsa-miR-663	CLIP-seq
MIRT1067105	hsa-miR-744	CLIP-seq
MIRT2016253	hsa-miR-129-3p	CLIP-seq
MIRT2016254	hsa-miR-146b-3p	CLIP-seq
MIRT1067103	hsa-miR-1908	CLIP-seq
MIRT2016255	hsa-miR-2964a-5p	CLIP-seq
MIRT2016256	hsa-miR-3622b-5p	CLIP-seq
MIRT2016257	hsa-miR-3945	CLIP-seq
MIRT2016258	hsa-miR-4253	CLIP-seq
MIRT2016259	hsa-miR-4687-5p	CLIP-seq
MIRT2016260	hsa-miR-486-5p	CLIP-seq
MIRT2016261	hsa-miR-541	CLIP-seq
MIRT2016262	hsa-miR-548ac	CLIP-seq
MIRT2016263	hsa-miR-548d-3p	CLIP-seq
MIRT2016264	hsa-miR-548z	CLIP-seq
MIRT2016265	hsa-miR-564	CLIP-seq
MIRT2016266	hsa-miR-654-5p	CLIP-seq
MIRT1067104	hsa-miR-663	CLIP-seq
MIRT1067105	hsa-miR-744	CLIP-seq
MIRT2248569	hsa-miR-1182	CLIP-seq
MIRT1067103	hsa-miR-1908	CLIP-seq
MIRT2248570	hsa-miR-1909	CLIP-seq
MIRT2248571	hsa-miR-214	CLIP-seq
MIRT2248572	hsa-miR-2355-5p	CLIP-seq
MIRT2016255	hsa-miR-2964a-5p	CLIP-seq
MIRT2248573	hsa-miR-3619-5p	CLIP-seq
MIRT2016256	hsa-miR-3622b-5p	CLIP-seq
MIRT2248574	hsa-miR-3665	CLIP-seq
MIRT2016257	hsa-miR-3945	CLIP-seq
MIRT2016258	hsa-miR-4253	CLIP-seq
MIRT2248575	hsa-miR-4530	CLIP-seq
MIRT2016261	hsa-miR-541	CLIP-seq
MIRT2016265	hsa-miR-564	CLIP-seq
MIRT2248576	hsa-miR-593	CLIP-seq
MIRT2016266	hsa-miR-654-5p	CLIP-seq
MIRT1067104	hsa-miR-663	CLIP-seq
MIRT1067105	hsa-miR-744	CLIP-seq
MIRT2248577	hsa-miR-761	CLIP-seq
MIRT1067103	hsa-miR-1908	CLIP-seq
MIRT2016257	hsa-miR-3945	CLIP-seq
MIRT2016258	hsa-miR-4253	CLIP-seq
MIRT2016261	hsa-miR-541	CLIP-seq
MIRT2016266	hsa-miR-654-5p	CLIP-seq
MIRT1067104	hsa-miR-663	CLIP-seq
MIRT1067105	hsa-miR-744	CLIP-seq

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	ISO
GO:0005515	Function	Protein binding	IPI	16230350, 18922472, 19615732, 21303910, 25416956, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0006275	Process	Regulation of DNA replication	IMP	25016522
GO:0006281	Process	DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	ISO
GO:0006310	Process	DNA recombination	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21303910
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0031011	Component	Ino80 complex	IBA
GO:0031011	Component	Ino80 complex	IDA	21303910
GO:0031011	Component	Ino80 complex	IEA
GO:0033044	Process	Regulation of chromosome organization	IMP	26340092
GO:0045739	Process	Positive regulation of DNA repair	ISO
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27641337
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0051726	Process	Regulation of cell cycle	IMP	26340092
GO:0060382	Process	Regulation of DNA strand elongation	IMP	25016522
GO:1904507	Process	Positive regulation of telomere maintenance in response to DNA damage	ISO

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8NBZ0
Protein name	INO80 complex subunit E (Coiled-coil domain-containing protein 95)
Protein function	Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Family and domains
Sequence	MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQY ENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPL QASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCP VGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVI DIPE
Sequence length	244
Interactions	View interactions

KEGG Pathway	Reactome Pathway
ATP-dependent chromatin remodeling	UCH proteinases
	DNA Damage Recognition in GG-NER

INO80E (INO80 complex subunit E)

Bookmark This Gene