HSP90AA1 (heat shock protein 90 alpha family class A member 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3320
• Gene name: Heat shock protein 90 alpha family class A member 1
• Gene symbol: HSP90AA1
• Synonyms (NCBI Gene): EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2
• Chromosome: 14
• Chromosome location: 14q32.31
• Summary: The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript

miRNA Show/Hide all (923)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020063	hsa-miR-375	Microarray	20215506
MIRT031959	hsa-miR-16-5p	Proteomics	18668040
MIRT052238	hsa-let-7b-5p	CLASH	23622248
MIRT050979	hsa-miR-17-5p	CLASH	23622248
MIRT050304	hsa-miR-25-3p	CLASH	23622248
MIRT047953	hsa-miR-30c-5p	CLASH	23622248
MIRT047507	hsa-miR-10a-5p	CLASH	23622248
MIRT047507	hsa-miR-10a-5p	CLASH	23622248
MIRT047124	hsa-miR-183-5p	CLASH	23622248
MIRT047015	hsa-miR-204-5p	CLASH	23622248
MIRT046648	hsa-miR-222-3p	CLASH	23622248
MIRT045325	hsa-miR-185-5p	CLASH	23622248
MIRT045178	hsa-miR-186-5p	CLASH	23622248
MIRT044155	hsa-miR-30e-5p	CLASH	23622248
MIRT043944	hsa-miR-378a-3p	CLASH	23622248
MIRT042829	hsa-miR-324-3p	CLASH	23622248
MIRT041642	hsa-miR-484	CLASH	23622248
MIRT041140	hsa-miR-501-5p	CLASH	23622248
MIRT039416	hsa-miR-421	CLASH	23622248
MIRT039331	hsa-miR-425-5p	CLASH	23622248
MIRT036729	hsa-miR-760	CLASH	23622248
MIRT036428	hsa-miR-1226-3p	CLASH	23622248
MIRT052896	hsa-miR-3943	CLASH	23622248
MIRT438032	hsa-miR-371a-5p	qRT-PCR	24367666
MIRT438031	hsa-miR-34c-5p	qRT-PCR	24367666
MIRT438030	hsa-miR-1323	qRT-PCR	24367666
MIRT438032	hsa-miR-371a-5p	qRT-PCR	24367666
MIRT438031	hsa-miR-34c-5p	qRT-PCR	24367666
MIRT438030	hsa-miR-1323	qRT-PCR	24367666
MIRT493579	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT511424	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT493577	hsa-miR-3125	PAR-CLIP	20371350
MIRT493576	hsa-miR-3916	PAR-CLIP	20371350
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT493574	hsa-miR-1278	PAR-CLIP	20371350
MIRT511423	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT511422	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT493571	hsa-miR-4257	PAR-CLIP	20371350
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT493566	hsa-miR-3674	PAR-CLIP	20371350
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT493579	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT511429	hsa-miR-5688	PAR-CLIP	20371350
MIRT511428	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT511427	hsa-miR-3133	PAR-CLIP	20371350
MIRT045178	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT567279	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT567278	hsa-miR-548ab	PAR-CLIP	20371350
MIRT567277	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT567276	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT567275	hsa-miR-548ak	PAR-CLIP	20371350
MIRT567274	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT567273	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT567272	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT567271	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT567270	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT567269	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT567268	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT567267	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT567266	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT567265	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT567264	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT567263	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT567262	hsa-miR-548i	PAR-CLIP	20371350
MIRT567261	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT567260	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT567259	hsa-miR-548w	PAR-CLIP	20371350
MIRT567258	hsa-miR-548y	PAR-CLIP	20371350
MIRT567257	hsa-miR-559	PAR-CLIP	20371350
MIRT567256	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT567255	hsa-miR-548k	PAR-CLIP	20371350
MIRT567254	hsa-miR-8054	PAR-CLIP	20371350
MIRT567253	hsa-miR-548l	PAR-CLIP	20371350
MIRT511426	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT511425	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT511424	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT493577	hsa-miR-3125	PAR-CLIP	20371350
MIRT493576	hsa-miR-3916	PAR-CLIP	20371350
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT493574	hsa-miR-1278	PAR-CLIP	20371350
MIRT567252	hsa-miR-1244	PAR-CLIP	20371350
MIRT511423	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT511422	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT567251	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT511420	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT493571	hsa-miR-4257	PAR-CLIP	20371350
MIRT567250	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT567249	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT190328	hsa-miR-4703-3p	PAR-CLIP	20371350
MIRT567248	hsa-miR-6755-3p	PAR-CLIP	20371350
MIRT277538	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT567247	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT567246	hsa-miR-5590-5p	PAR-CLIP	20371350
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT493566	hsa-miR-3674	PAR-CLIP	20371350
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT493579	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT511429	hsa-miR-5688	PAR-CLIP	20371350
MIRT511428	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT511427	hsa-miR-3133	PAR-CLIP	20371350
MIRT045178	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT511426	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT511425	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT511424	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT493577	hsa-miR-3125	PAR-CLIP	20371350
MIRT493576	hsa-miR-3916	PAR-CLIP	20371350
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT493574	hsa-miR-1278	PAR-CLIP	20371350
MIRT511423	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT511422	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT493571	hsa-miR-4257	PAR-CLIP	20371350
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT277538	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT493566	hsa-miR-3674	PAR-CLIP	20371350
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT493579	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	21572407
MIRT493577	hsa-miR-3125	PAR-CLIP	21572407
MIRT493576	hsa-miR-3916	PAR-CLIP	21572407
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	21572407
MIRT493574	hsa-miR-1278	PAR-CLIP	21572407
MIRT511423	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT511422	hsa-miR-362-5p	PAR-CLIP	21572407
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	21572407
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	21572407
MIRT493571	hsa-miR-4257	PAR-CLIP	21572407
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	21572407
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	21572407
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT493566	hsa-miR-3674	PAR-CLIP	21572407
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT541200	hsa-miR-497-3p	PAR-CLIP	21572407
MIRT541199	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT541198	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT541197	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT277530	hsa-miR-4677-3p	PAR-CLIP	21572407
MIRT277531	hsa-miR-4679	PAR-CLIP	21572407
MIRT541196	hsa-miR-600	PAR-CLIP	21572407
MIRT541195	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT541194	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT541193	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT541192	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT541191	hsa-miR-6798-3p	PAR-CLIP	21572407
MIRT541190	hsa-miR-139-5p	PAR-CLIP	21572407
MIRT493579	hsa-miR-361-5p	PAR-CLIP	23446348
MIRT511429	hsa-miR-5688	PAR-CLIP	23446348
MIRT511428	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT511427	hsa-miR-3133	PAR-CLIP	23446348
MIRT045178	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT511426	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT511425	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT511424	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT493577	hsa-miR-3125	PAR-CLIP	23446348
MIRT493576	hsa-miR-3916	PAR-CLIP	23446348
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT493574	hsa-miR-1278	PAR-CLIP	23446348
MIRT511423	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT511422	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT511420	hsa-miR-499b-5p	PAR-CLIP	23446348
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	23446348
MIRT493571	hsa-miR-4257	PAR-CLIP	23446348
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	23446348
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT277538	hsa-miR-889-3p	PAR-CLIP	23446348
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT493566	hsa-miR-3674	PAR-CLIP	23446348
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	23446348
MIRT493579	hsa-miR-361-5p	PAR-CLIP	23592263
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT493577	hsa-miR-3125	PAR-CLIP	23592263
MIRT493576	hsa-miR-3916	PAR-CLIP	23592263
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT493574	hsa-miR-1278	PAR-CLIP	23592263
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	23592263
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT493571	hsa-miR-4257	PAR-CLIP	23592263
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	23592263
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	23592263
MIRT493566	hsa-miR-3674	PAR-CLIP	23592263
MIRT541198	hsa-miR-148b-3p	Luciferase reporter assay, qRT-PCR, Western blot	28337290
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	26701625
MIRT493574	hsa-miR-1278	PAR-CLIP	26701625
MIRT493574	hsa-miR-1278	PAR-CLIP	26701625
MIRT493574	hsa-miR-1278	PAR-CLIP	26701625
MIRT493574	hsa-miR-1278	PAR-CLIP	26701625
MIRT493574	hsa-miR-1278	PAR-CLIP	26701625
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	26701625
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	26701625
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	26701625
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	26701625
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	26701625
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	26701625
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	26701625
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	26701625
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	26701625
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	26701625
MIRT511424	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT511424	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT511424	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT511424	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT511424	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	26701625
MIRT493577	hsa-miR-3125	PAR-CLIP	26701625
MIRT493577	hsa-miR-3125	PAR-CLIP	26701625
MIRT493577	hsa-miR-3125	PAR-CLIP	26701625
MIRT493577	hsa-miR-3125	PAR-CLIP	26701625
MIRT493577	hsa-miR-3125	PAR-CLIP	26701625
MIRT493579	hsa-miR-361-5p	PAR-CLIP	26701625
MIRT493579	hsa-miR-361-5p	PAR-CLIP	26701625
MIRT493579	hsa-miR-361-5p	PAR-CLIP	26701625
MIRT493579	hsa-miR-361-5p	PAR-CLIP	26701625
MIRT493579	hsa-miR-361-5p	PAR-CLIP	26701625
MIRT511422	hsa-miR-362-5p	PAR-CLIP	26701625
MIRT493566	hsa-miR-3674	PAR-CLIP	26701625
MIRT493566	hsa-miR-3674	PAR-CLIP	26701625
MIRT493566	hsa-miR-3674	PAR-CLIP	26701625
MIRT493566	hsa-miR-3674	PAR-CLIP	26701625
MIRT493566	hsa-miR-3674	PAR-CLIP	26701625
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	26701625
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	26701625
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	26701625
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	26701625
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	26701625
MIRT493576	hsa-miR-3916	PAR-CLIP	26701625
MIRT493576	hsa-miR-3916	PAR-CLIP	26701625
MIRT493576	hsa-miR-3916	PAR-CLIP	26701625
MIRT493576	hsa-miR-3916	PAR-CLIP	26701625
MIRT493576	hsa-miR-3916	PAR-CLIP	26701625
MIRT493571	hsa-miR-4257	PAR-CLIP	26701625
MIRT493571	hsa-miR-4257	PAR-CLIP	26701625
MIRT493571	hsa-miR-4257	PAR-CLIP	26701625
MIRT493571	hsa-miR-4257	PAR-CLIP	26701625
MIRT493571	hsa-miR-4257	PAR-CLIP	26701625
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	26701625
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	26701625
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	26701625
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	26701625
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	26701625
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	26701625
MIRT511423	hsa-miR-656-3p	PAR-CLIP	26701625
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	26701625
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT493579	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT511424	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT493577	hsa-miR-3125	PAR-CLIP	20371350
MIRT493576	hsa-miR-3916	PAR-CLIP	20371350
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT493574	hsa-miR-1278	PAR-CLIP	20371350
MIRT511423	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT511422	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT493571	hsa-miR-4257	PAR-CLIP	20371350
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT493566	hsa-miR-3674	PAR-CLIP	20371350
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT493579	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT511429	hsa-miR-5688	PAR-CLIP	20371350
MIRT511428	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT511427	hsa-miR-3133	PAR-CLIP	20371350
MIRT045178	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT567279	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT567278	hsa-miR-548ab	PAR-CLIP	20371350
MIRT567277	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT567276	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT567275	hsa-miR-548ak	PAR-CLIP	20371350
MIRT567274	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT567273	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT567272	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT567271	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT567270	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT567269	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT567268	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT567267	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT567266	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT567265	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT567264	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT567263	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT567262	hsa-miR-548i	PAR-CLIP	20371350
MIRT567261	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT567260	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT567259	hsa-miR-548w	PAR-CLIP	20371350
MIRT567258	hsa-miR-548y	PAR-CLIP	20371350
MIRT567257	hsa-miR-559	PAR-CLIP	20371350
MIRT567256	hsa-miR-548av-5p	PAR-CLIP	20371350
MIRT567255	hsa-miR-548k	PAR-CLIP	20371350
MIRT567254	hsa-miR-8054	PAR-CLIP	20371350
MIRT567253	hsa-miR-548l	PAR-CLIP	20371350
MIRT511426	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT511425	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT511424	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT493577	hsa-miR-3125	PAR-CLIP	20371350
MIRT493576	hsa-miR-3916	PAR-CLIP	20371350
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT493574	hsa-miR-1278	PAR-CLIP	20371350
MIRT567252	hsa-miR-1244	PAR-CLIP	20371350
MIRT511423	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT511422	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT567251	hsa-miR-141-5p	PAR-CLIP	20371350
MIRT511420	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT493571	hsa-miR-4257	PAR-CLIP	20371350
MIRT567250	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT567249	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT190328	hsa-miR-4703-3p	PAR-CLIP	20371350
MIRT567248	hsa-miR-6755-3p	PAR-CLIP	20371350
MIRT277538	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT567247	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT567246	hsa-miR-5590-5p	PAR-CLIP	20371350
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT493566	hsa-miR-3674	PAR-CLIP	20371350
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT493579	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT511429	hsa-miR-5688	PAR-CLIP	20371350
MIRT511428	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT511427	hsa-miR-3133	PAR-CLIP	20371350
MIRT045178	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT511426	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT511425	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT511424	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT493577	hsa-miR-3125	PAR-CLIP	20371350
MIRT493576	hsa-miR-3916	PAR-CLIP	20371350
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT493574	hsa-miR-1278	PAR-CLIP	20371350
MIRT511423	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT511422	hsa-miR-362-5p	PAR-CLIP	20371350
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	20371350
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT493571	hsa-miR-4257	PAR-CLIP	20371350
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	20371350
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	20371350
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	20371350
MIRT277538	hsa-miR-889-3p	PAR-CLIP	20371350
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT493566	hsa-miR-3674	PAR-CLIP	20371350
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT493579	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	21572407
MIRT493577	hsa-miR-3125	PAR-CLIP	21572407
MIRT493576	hsa-miR-3916	PAR-CLIP	21572407
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	21572407
MIRT493574	hsa-miR-1278	PAR-CLIP	21572407
MIRT511423	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT511422	hsa-miR-362-5p	PAR-CLIP	21572407
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	21572407
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	21572407
MIRT493571	hsa-miR-4257	PAR-CLIP	21572407
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	21572407
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	21572407
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	21572407
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT493566	hsa-miR-3674	PAR-CLIP	21572407
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT541200	hsa-miR-497-3p	PAR-CLIP	21572407
MIRT541199	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT541198	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT541197	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT277530	hsa-miR-4677-3p	PAR-CLIP	21572407
MIRT277531	hsa-miR-4679	PAR-CLIP	21572407
MIRT541196	hsa-miR-600	PAR-CLIP	21572407
MIRT541195	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT541194	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT541193	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT541192	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT541191	hsa-miR-6798-3p	PAR-CLIP	21572407
MIRT541190	hsa-miR-139-5p	PAR-CLIP	21572407
MIRT493579	hsa-miR-361-5p	PAR-CLIP	23446348
MIRT511429	hsa-miR-5688	PAR-CLIP	23446348
MIRT511428	hsa-miR-495-3p	PAR-CLIP	23446348
MIRT511427	hsa-miR-3133	PAR-CLIP	23446348
MIRT045178	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT511426	hsa-miR-7-1-3p	PAR-CLIP	23446348
MIRT511425	hsa-miR-7-2-3p	PAR-CLIP	23446348
MIRT511424	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT069282	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT493577	hsa-miR-3125	PAR-CLIP	23446348
MIRT493576	hsa-miR-3916	PAR-CLIP	23446348
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT493574	hsa-miR-1278	PAR-CLIP	23446348
MIRT511423	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT511422	hsa-miR-362-5p	PAR-CLIP	23446348
MIRT511421	hsa-miR-500b-5p	PAR-CLIP	23446348
MIRT511420	hsa-miR-499b-5p	PAR-CLIP	23446348
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	23446348
MIRT493571	hsa-miR-4257	PAR-CLIP	23446348
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	23446348
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT277538	hsa-miR-889-3p	PAR-CLIP	23446348
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT493566	hsa-miR-3674	PAR-CLIP	23446348
MIRT044155	hsa-miR-30e-5p	PAR-CLIP	23446348
MIRT493579	hsa-miR-361-5p	PAR-CLIP	23592263
MIRT493578	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT493577	hsa-miR-3125	PAR-CLIP	23592263
MIRT493576	hsa-miR-3916	PAR-CLIP	23592263
MIRT493575	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT493574	hsa-miR-1278	PAR-CLIP	23592263
MIRT493573	hsa-miR-2115-3p	PAR-CLIP	23592263
MIRT493572	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT493571	hsa-miR-4257	PAR-CLIP	23592263
MIRT493570	hsa-miR-219a-2-3p	PAR-CLIP	23592263
MIRT493569	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT493568	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT493567	hsa-miR-374a-3p	PAR-CLIP	23592263
MIRT493566	hsa-miR-3674	PAR-CLIP	23592263
MIRT541194	hsa-miR-550a-3p	Western blotting, Microarray, qRT-PCR	35352023
MIRT1055774	hsa-miR-133a	CLIP-seq
MIRT1055775	hsa-miR-133b	CLIP-seq
MIRT1055776	hsa-miR-134	CLIP-seq
MIRT1055777	hsa-miR-146b-3p	CLIP-seq
MIRT1055778	hsa-miR-148a	CLIP-seq
MIRT1055779	hsa-miR-148b	CLIP-seq
MIRT1055780	hsa-miR-152	CLIP-seq
MIRT1055781	hsa-miR-185	CLIP-seq
MIRT1055782	hsa-miR-186	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055784	hsa-miR-196a	CLIP-seq
MIRT1055785	hsa-miR-196b	CLIP-seq
MIRT1055786	hsa-miR-219-2-3p	CLIP-seq
MIRT1055787	hsa-miR-224	CLIP-seq
MIRT1055788	hsa-miR-2277-3p	CLIP-seq
MIRT1055789	hsa-miR-298	CLIP-seq
MIRT1055790	hsa-miR-3118	CLIP-seq
MIRT1055791	hsa-miR-3119	CLIP-seq
MIRT1055792	hsa-miR-3148	CLIP-seq
MIRT1055793	hsa-miR-3157-5p	CLIP-seq
MIRT1055794	hsa-miR-3164	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055796	hsa-miR-331-5p	CLIP-seq
MIRT1055797	hsa-miR-3591-5p	CLIP-seq
MIRT1055798	hsa-miR-3613-3p	CLIP-seq
MIRT1055799	hsa-miR-3617	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055801	hsa-miR-3667-3p	CLIP-seq
MIRT1055802	hsa-miR-371-3p	CLIP-seq
MIRT1055803	hsa-miR-371b-3p	CLIP-seq
MIRT1055804	hsa-miR-371b-5p	CLIP-seq
MIRT1055805	hsa-miR-377	CLIP-seq
MIRT1055806	hsa-miR-3923	CLIP-seq
MIRT1055807	hsa-miR-3927	CLIP-seq
MIRT1055808	hsa-miR-3977	CLIP-seq
MIRT1055809	hsa-miR-3978	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055811	hsa-miR-4263	CLIP-seq
MIRT1055812	hsa-miR-4268	CLIP-seq
MIRT1055813	hsa-miR-4306	CLIP-seq
MIRT1055814	hsa-miR-4328	CLIP-seq
MIRT1055815	hsa-miR-4422	CLIP-seq
MIRT1055816	hsa-miR-4423-3p	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055818	hsa-miR-4448	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055820	hsa-miR-4473	CLIP-seq
MIRT1055821	hsa-miR-4501	CLIP-seq
MIRT1055822	hsa-miR-4503	CLIP-seq
MIRT1055823	hsa-miR-4644	CLIP-seq
MIRT1055824	hsa-miR-4661-5p	CLIP-seq
MIRT1055825	hsa-miR-4671-3p	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055827	hsa-miR-4691-3p	CLIP-seq
MIRT1055828	hsa-miR-4691-5p	CLIP-seq
MIRT1055829	hsa-miR-4738-3p	CLIP-seq
MIRT1055830	hsa-miR-4759	CLIP-seq
MIRT1055831	hsa-miR-4777-5p	CLIP-seq
MIRT1055832	hsa-miR-4799-5p	CLIP-seq
MIRT1055833	hsa-miR-495	CLIP-seq
MIRT1055834	hsa-miR-499a-5p	CLIP-seq
MIRT1055835	hsa-miR-500b	CLIP-seq
MIRT1055836	hsa-miR-505	CLIP-seq
MIRT1055837	hsa-miR-515-3p	CLIP-seq
MIRT1055838	hsa-miR-518d-5p	CLIP-seq
MIRT1055839	hsa-miR-519b-5p	CLIP-seq
MIRT1055840	hsa-miR-519c-5p	CLIP-seq
MIRT1055841	hsa-miR-519e	CLIP-seq
MIRT1055842	hsa-miR-520c-5p	CLIP-seq
MIRT1055843	hsa-miR-526a	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055846	hsa-miR-548h	CLIP-seq
MIRT1055847	hsa-miR-548j	CLIP-seq
MIRT1055848	hsa-miR-548n	CLIP-seq
MIRT1055849	hsa-miR-570	CLIP-seq
MIRT1055850	hsa-miR-576-5p	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055852	hsa-miR-601	CLIP-seq
MIRT1055853	hsa-miR-641	CLIP-seq
MIRT1055854	hsa-miR-656	CLIP-seq
MIRT1055855	hsa-miR-877	CLIP-seq
MIRT1055856	hsa-miR-888	CLIP-seq
MIRT1055857	hsa-miR-889	CLIP-seq
MIRT1055858	hsa-miR-9	CLIP-seq
MIRT1055859	hsa-miR-934	CLIP-seq
MIRT1055860	hsa-miR-1231	CLIP-seq
MIRT1055778	hsa-miR-148a	CLIP-seq
MIRT1055779	hsa-miR-148b	CLIP-seq
MIRT1055780	hsa-miR-152	CLIP-seq
MIRT1055861	hsa-miR-1909	CLIP-seq
MIRT1055784	hsa-miR-196a	CLIP-seq
MIRT1055785	hsa-miR-196b	CLIP-seq
MIRT1055786	hsa-miR-219-2-3p	CLIP-seq
MIRT1055789	hsa-miR-298	CLIP-seq
MIRT1055791	hsa-miR-3119	CLIP-seq
MIRT1055862	hsa-miR-3143	CLIP-seq
MIRT1055796	hsa-miR-331-5p	CLIP-seq
MIRT1055863	hsa-miR-346	CLIP-seq
MIRT1055799	hsa-miR-3617	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055805	hsa-miR-377	CLIP-seq
MIRT1055806	hsa-miR-3923	CLIP-seq
MIRT1055807	hsa-miR-3927	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055812	hsa-miR-4268	CLIP-seq
MIRT1055864	hsa-miR-4288	CLIP-seq
MIRT1055814	hsa-miR-4328	CLIP-seq
MIRT1055818	hsa-miR-4448	CLIP-seq
MIRT1055865	hsa-miR-4652-3p	CLIP-seq
MIRT1055828	hsa-miR-4691-5p	CLIP-seq
MIRT1055830	hsa-miR-4759	CLIP-seq
MIRT1055831	hsa-miR-4777-5p	CLIP-seq
MIRT1055836	hsa-miR-505	CLIP-seq
MIRT1055838	hsa-miR-518d-5p	CLIP-seq
MIRT1055839	hsa-miR-519b-5p	CLIP-seq
MIRT1055840	hsa-miR-519c-5p	CLIP-seq
MIRT1055842	hsa-miR-520c-5p	CLIP-seq
MIRT1055843	hsa-miR-526a	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055866	hsa-miR-550a	CLIP-seq
MIRT1055867	hsa-miR-632	CLIP-seq
MIRT1055853	hsa-miR-641	CLIP-seq
MIRT1055855	hsa-miR-877	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055786	hsa-miR-219-2-3p	CLIP-seq
MIRT1055774	hsa-miR-133a	CLIP-seq
MIRT1055775	hsa-miR-133b	CLIP-seq
MIRT1055776	hsa-miR-134	CLIP-seq
MIRT1055777	hsa-miR-146b-3p	CLIP-seq
MIRT1055778	hsa-miR-148a	CLIP-seq
MIRT1055779	hsa-miR-148b	CLIP-seq
MIRT1055780	hsa-miR-152	CLIP-seq
MIRT1055781	hsa-miR-185	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055784	hsa-miR-196a	CLIP-seq
MIRT1055785	hsa-miR-196b	CLIP-seq
MIRT1055786	hsa-miR-219-2-3p	CLIP-seq
MIRT1055787	hsa-miR-224	CLIP-seq
MIRT1055788	hsa-miR-2277-3p	CLIP-seq
MIRT1055789	hsa-miR-298	CLIP-seq
MIRT1055790	hsa-miR-3118	CLIP-seq
MIRT1055791	hsa-miR-3119	CLIP-seq
MIRT1055862	hsa-miR-3143	CLIP-seq
MIRT1055792	hsa-miR-3148	CLIP-seq
MIRT1055793	hsa-miR-3157-5p	CLIP-seq
MIRT1055794	hsa-miR-3164	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055796	hsa-miR-331-5p	CLIP-seq
MIRT1055797	hsa-miR-3591-5p	CLIP-seq
MIRT1055798	hsa-miR-3613-3p	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055801	hsa-miR-3667-3p	CLIP-seq
MIRT2012816	hsa-miR-3684	CLIP-seq
MIRT1055802	hsa-miR-371-3p	CLIP-seq
MIRT1055803	hsa-miR-371b-3p	CLIP-seq
MIRT1055806	hsa-miR-3923	CLIP-seq
MIRT1055807	hsa-miR-3927	CLIP-seq
MIRT1055808	hsa-miR-3977	CLIP-seq
MIRT1055809	hsa-miR-3978	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055811	hsa-miR-4263	CLIP-seq
MIRT1055812	hsa-miR-4268	CLIP-seq
MIRT1055813	hsa-miR-4306	CLIP-seq
MIRT1055814	hsa-miR-4328	CLIP-seq
MIRT1055816	hsa-miR-4423-3p	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055818	hsa-miR-4448	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055820	hsa-miR-4473	CLIP-seq
MIRT1055821	hsa-miR-4501	CLIP-seq
MIRT1055822	hsa-miR-4503	CLIP-seq
MIRT1055823	hsa-miR-4644	CLIP-seq
MIRT1055824	hsa-miR-4661-5p	CLIP-seq
MIRT1055825	hsa-miR-4671-3p	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055827	hsa-miR-4691-3p	CLIP-seq
MIRT1055828	hsa-miR-4691-5p	CLIP-seq
MIRT2012817	hsa-miR-4742-3p	CLIP-seq
MIRT1055830	hsa-miR-4759	CLIP-seq
MIRT1055831	hsa-miR-4777-5p	CLIP-seq
MIRT1055832	hsa-miR-4799-5p	CLIP-seq
MIRT2012818	hsa-miR-490-5p	CLIP-seq
MIRT1055833	hsa-miR-495	CLIP-seq
MIRT1055834	hsa-miR-499a-5p	CLIP-seq
MIRT1055835	hsa-miR-500b	CLIP-seq
MIRT1055836	hsa-miR-505	CLIP-seq
MIRT1055837	hsa-miR-515-3p	CLIP-seq
MIRT1055838	hsa-miR-518d-5p	CLIP-seq
MIRT1055839	hsa-miR-519b-5p	CLIP-seq
MIRT1055840	hsa-miR-519c-5p	CLIP-seq
MIRT1055841	hsa-miR-519e	CLIP-seq
MIRT1055842	hsa-miR-520c-5p	CLIP-seq
MIRT1055843	hsa-miR-526a	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055846	hsa-miR-548h	CLIP-seq
MIRT1055847	hsa-miR-548j	CLIP-seq
MIRT1055848	hsa-miR-548n	CLIP-seq
MIRT1055849	hsa-miR-570	CLIP-seq
MIRT1055850	hsa-miR-576-5p	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055852	hsa-miR-601	CLIP-seq
MIRT1055854	hsa-miR-656	CLIP-seq
MIRT1055855	hsa-miR-877	CLIP-seq
MIRT1055857	hsa-miR-889	CLIP-seq
MIRT1055858	hsa-miR-9	CLIP-seq
MIRT1055859	hsa-miR-934	CLIP-seq
MIRT1055774	hsa-miR-133a	CLIP-seq
MIRT1055775	hsa-miR-133b	CLIP-seq
MIRT1055776	hsa-miR-134	CLIP-seq
MIRT1055777	hsa-miR-146b-3p	CLIP-seq
MIRT1055778	hsa-miR-148a	CLIP-seq
MIRT1055779	hsa-miR-148b	CLIP-seq
MIRT1055780	hsa-miR-152	CLIP-seq
MIRT1055781	hsa-miR-185	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055784	hsa-miR-196a	CLIP-seq
MIRT1055785	hsa-miR-196b	CLIP-seq
MIRT1055786	hsa-miR-219-2-3p	CLIP-seq
MIRT1055787	hsa-miR-224	CLIP-seq
MIRT1055788	hsa-miR-2277-3p	CLIP-seq
MIRT1055789	hsa-miR-298	CLIP-seq
MIRT2245150	hsa-miR-3117-5p	CLIP-seq
MIRT1055790	hsa-miR-3118	CLIP-seq
MIRT1055791	hsa-miR-3119	CLIP-seq
MIRT2245151	hsa-miR-3138	CLIP-seq
MIRT1055792	hsa-miR-3148	CLIP-seq
MIRT1055793	hsa-miR-3157-5p	CLIP-seq
MIRT1055794	hsa-miR-3164	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055796	hsa-miR-331-5p	CLIP-seq
MIRT1055797	hsa-miR-3591-5p	CLIP-seq
MIRT1055798	hsa-miR-3613-3p	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055801	hsa-miR-3667-3p	CLIP-seq
MIRT2012816	hsa-miR-3684	CLIP-seq
MIRT1055802	hsa-miR-371-3p	CLIP-seq
MIRT1055803	hsa-miR-371b-3p	CLIP-seq
MIRT1055804	hsa-miR-371b-5p	CLIP-seq
MIRT1055806	hsa-miR-3923	CLIP-seq
MIRT2245152	hsa-miR-3925-5p	CLIP-seq
MIRT1055807	hsa-miR-3927	CLIP-seq
MIRT1055808	hsa-miR-3977	CLIP-seq
MIRT1055809	hsa-miR-3978	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055811	hsa-miR-4263	CLIP-seq
MIRT1055812	hsa-miR-4268	CLIP-seq
MIRT1055813	hsa-miR-4306	CLIP-seq
MIRT1055814	hsa-miR-4328	CLIP-seq
MIRT1055815	hsa-miR-4422	CLIP-seq
MIRT1055816	hsa-miR-4423-3p	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055818	hsa-miR-4448	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055820	hsa-miR-4473	CLIP-seq
MIRT1055821	hsa-miR-4501	CLIP-seq
MIRT1055822	hsa-miR-4503	CLIP-seq
MIRT2245153	hsa-miR-4643	CLIP-seq
MIRT1055823	hsa-miR-4644	CLIP-seq
MIRT1055824	hsa-miR-4661-5p	CLIP-seq
MIRT1055825	hsa-miR-4671-3p	CLIP-seq
MIRT2245154	hsa-miR-4678	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055827	hsa-miR-4691-3p	CLIP-seq
MIRT1055828	hsa-miR-4691-5p	CLIP-seq
MIRT1055829	hsa-miR-4738-3p	CLIP-seq
MIRT2012817	hsa-miR-4742-3p	CLIP-seq
MIRT1055830	hsa-miR-4759	CLIP-seq
MIRT1055831	hsa-miR-4777-5p	CLIP-seq
MIRT1055832	hsa-miR-4799-5p	CLIP-seq
MIRT2012818	hsa-miR-490-5p	CLIP-seq
MIRT1055834	hsa-miR-499a-5p	CLIP-seq
MIRT1055836	hsa-miR-505	CLIP-seq
MIRT1055837	hsa-miR-515-3p	CLIP-seq
MIRT1055838	hsa-miR-518d-5p	CLIP-seq
MIRT1055839	hsa-miR-519b-5p	CLIP-seq
MIRT1055840	hsa-miR-519c-5p	CLIP-seq
MIRT1055841	hsa-miR-519e	CLIP-seq
MIRT1055842	hsa-miR-520c-5p	CLIP-seq
MIRT1055843	hsa-miR-526a	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055846	hsa-miR-548h	CLIP-seq
MIRT1055847	hsa-miR-548j	CLIP-seq
MIRT1055848	hsa-miR-548n	CLIP-seq
MIRT2245155	hsa-miR-548o	CLIP-seq
MIRT1055849	hsa-miR-570	CLIP-seq
MIRT1055850	hsa-miR-576-5p	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055852	hsa-miR-601	CLIP-seq
MIRT1055854	hsa-miR-656	CLIP-seq
MIRT1055855	hsa-miR-877	CLIP-seq
MIRT1055856	hsa-miR-888	CLIP-seq
MIRT1055857	hsa-miR-889	CLIP-seq
MIRT1055859	hsa-miR-934	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055786	hsa-miR-219-2-3p	CLIP-seq
MIRT1055789	hsa-miR-298	CLIP-seq
MIRT1055806	hsa-miR-3923	CLIP-seq
MIRT1055830	hsa-miR-4759	CLIP-seq
MIRT1055831	hsa-miR-4777-5p	CLIP-seq
MIRT1055836	hsa-miR-505	CLIP-seq
MIRT1055838	hsa-miR-518d-5p	CLIP-seq
MIRT1055839	hsa-miR-519b-5p	CLIP-seq
MIRT1055840	hsa-miR-519c-5p	CLIP-seq
MIRT1055842	hsa-miR-520c-5p	CLIP-seq
MIRT1055843	hsa-miR-526a	CLIP-seq
MIRT1055855	hsa-miR-877	CLIP-seq
MIRT1055782	hsa-miR-186	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055797	hsa-miR-3591-5p	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055802	hsa-miR-371-3p	CLIP-seq
MIRT1055803	hsa-miR-371b-3p	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055820	hsa-miR-4473	CLIP-seq
MIRT1055824	hsa-miR-4661-5p	CLIP-seq
MIRT1055825	hsa-miR-4671-3p	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055833	hsa-miR-495	CLIP-seq
MIRT1055834	hsa-miR-499a-5p	CLIP-seq
MIRT1055835	hsa-miR-500b	CLIP-seq
MIRT1055837	hsa-miR-515-3p	CLIP-seq
MIRT1055841	hsa-miR-519e	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055846	hsa-miR-548h	CLIP-seq
MIRT1055847	hsa-miR-548j	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055854	hsa-miR-656	CLIP-seq
MIRT1055857	hsa-miR-889	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055776	hsa-miR-134	CLIP-seq
MIRT1055778	hsa-miR-148a	CLIP-seq
MIRT1055779	hsa-miR-148b	CLIP-seq
MIRT1055780	hsa-miR-152	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055784	hsa-miR-196a	CLIP-seq
MIRT1055785	hsa-miR-196b	CLIP-seq
MIRT1055790	hsa-miR-3118	CLIP-seq
MIRT1055791	hsa-miR-3119	CLIP-seq
MIRT1055792	hsa-miR-3148	CLIP-seq
MIRT1055794	hsa-miR-3164	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055796	hsa-miR-331-5p	CLIP-seq
MIRT2548074	hsa-miR-338-5p	CLIP-seq
MIRT1055797	hsa-miR-3591-5p	CLIP-seq
MIRT1055798	hsa-miR-3613-3p	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT1055802	hsa-miR-371-3p	CLIP-seq
MIRT1055803	hsa-miR-371b-3p	CLIP-seq
MIRT1055804	hsa-miR-371b-5p	CLIP-seq
MIRT1055805	hsa-miR-377	CLIP-seq
MIRT1055807	hsa-miR-3927	CLIP-seq
MIRT1055809	hsa-miR-3978	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055812	hsa-miR-4268	CLIP-seq
MIRT1055815	hsa-miR-4422	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055818	hsa-miR-4448	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055820	hsa-miR-4473	CLIP-seq
MIRT1055821	hsa-miR-4501	CLIP-seq
MIRT1055822	hsa-miR-4503	CLIP-seq
MIRT1055824	hsa-miR-4661-5p	CLIP-seq
MIRT1055825	hsa-miR-4671-3p	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055828	hsa-miR-4691-5p	CLIP-seq
MIRT1055829	hsa-miR-4738-3p	CLIP-seq
MIRT2012817	hsa-miR-4742-3p	CLIP-seq
MIRT2548075	hsa-miR-4764-3p	CLIP-seq
MIRT1055834	hsa-miR-499a-5p	CLIP-seq
MIRT1055837	hsa-miR-515-3p	CLIP-seq
MIRT1055841	hsa-miR-519e	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055846	hsa-miR-548h	CLIP-seq
MIRT1055847	hsa-miR-548j	CLIP-seq
MIRT1055849	hsa-miR-570	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055856	hsa-miR-888	CLIP-seq
MIRT1055858	hsa-miR-9	CLIP-seq
MIRT1055776	hsa-miR-134	CLIP-seq
MIRT1055777	hsa-miR-146b-3p	CLIP-seq
MIRT1055778	hsa-miR-148a	CLIP-seq
MIRT1055779	hsa-miR-148b	CLIP-seq
MIRT1055780	hsa-miR-152	CLIP-seq
MIRT1055783	hsa-miR-193a-5p	CLIP-seq
MIRT1055784	hsa-miR-196a	CLIP-seq
MIRT1055785	hsa-miR-196b	CLIP-seq
MIRT1055788	hsa-miR-2277-3p	CLIP-seq
MIRT1055790	hsa-miR-3118	CLIP-seq
MIRT1055791	hsa-miR-3119	CLIP-seq
MIRT1055862	hsa-miR-3143	CLIP-seq
MIRT1055792	hsa-miR-3148	CLIP-seq
MIRT1055794	hsa-miR-3164	CLIP-seq
MIRT1055795	hsa-miR-3194-3p	CLIP-seq
MIRT1055796	hsa-miR-331-5p	CLIP-seq
MIRT2548074	hsa-miR-338-5p	CLIP-seq
MIRT1055797	hsa-miR-3591-5p	CLIP-seq
MIRT1055798	hsa-miR-3613-3p	CLIP-seq
MIRT1055800	hsa-miR-3647-3p	CLIP-seq
MIRT2012816	hsa-miR-3684	CLIP-seq
MIRT1055802	hsa-miR-371-3p	CLIP-seq
MIRT1055803	hsa-miR-371b-3p	CLIP-seq
MIRT1055804	hsa-miR-371b-5p	CLIP-seq
MIRT1055805	hsa-miR-377	CLIP-seq
MIRT1055807	hsa-miR-3927	CLIP-seq
MIRT1055809	hsa-miR-3978	CLIP-seq
MIRT1055810	hsa-miR-411	CLIP-seq
MIRT1055812	hsa-miR-4268	CLIP-seq
MIRT1055815	hsa-miR-4422	CLIP-seq
MIRT1055817	hsa-miR-4424	CLIP-seq
MIRT1055818	hsa-miR-4448	CLIP-seq
MIRT1055819	hsa-miR-4463	CLIP-seq
MIRT1055820	hsa-miR-4473	CLIP-seq
MIRT1055821	hsa-miR-4501	CLIP-seq
MIRT1055822	hsa-miR-4503	CLIP-seq
MIRT1055824	hsa-miR-4661-5p	CLIP-seq
MIRT1055825	hsa-miR-4671-3p	CLIP-seq
MIRT1055826	hsa-miR-4682	CLIP-seq
MIRT1055828	hsa-miR-4691-5p	CLIP-seq
MIRT1055829	hsa-miR-4738-3p	CLIP-seq
MIRT2012817	hsa-miR-4742-3p	CLIP-seq
MIRT2548075	hsa-miR-4764-3p	CLIP-seq
MIRT1055837	hsa-miR-515-3p	CLIP-seq
MIRT1055841	hsa-miR-519e	CLIP-seq
MIRT1055844	hsa-miR-548ag	CLIP-seq
MIRT1055845	hsa-miR-548ai	CLIP-seq
MIRT1055846	hsa-miR-548h	CLIP-seq
MIRT1055847	hsa-miR-548j	CLIP-seq
MIRT1055849	hsa-miR-570	CLIP-seq
MIRT1055851	hsa-miR-587	CLIP-seq
MIRT1055856	hsa-miR-888	CLIP-seq
MIRT1055858	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
POU4F1	Activation	15818685
POU4F2	Activation	15818685
STAT1	Repression	12940076

Gene ontology (GO) Show/Hide all (150)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0002134	Function	UTP binding	IEA
GO:0002135	Function	CTP binding	IEA
GO:0002218	Process	Activation of innate immune response	IDA	20628368
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	20628368
GO:0003009	Process	Skeletal muscle contraction	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9660753, 9817749, 12176997, 12526792, 12604615, 12853476, 12855682, 14638689, 14676191, 14743216, 15347682, 15708368, 16049941, 16169070, 16275660, 16307917, 16844778, 16888650, 17024179, 18195352, 19026643, 19740745, 19875381, 20029029, 20133715, 20188096, 20195357, 20353823, 20374
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IDA	27353360
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10791971
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IDA	25609812
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	12526792
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0006839	Process	Mitochondrial transport	TAS	12526792
GO:0006986	Process	Response to unfolded protein	NAS	2527334
GO:0007004	Process	Telomere maintenance via telomerase	IDA	10197982
GO:0007004	Process	Telomere maintenance via telomerase	IEA
GO:0009408	Process	Response to heat	ISS
GO:0009409	Process	Response to cold	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009651	Process	Response to salt stress	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010592	Process	Positive regulation of lamellipodium assembly	IEA
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IDA	15937123, 29127155
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0016887	Function	ATP hydrolysis activity	TAS
GO:0017098	Function	Sulfonylurea receptor binding	IEA
GO:0019903	Function	Protein phosphatase binding	IEA
GO:0023026	Function	MHC class II protein complex binding	HDA	20458337
GO:0030150	Process	Protein import into mitochondrial matrix	IDA	15644312
GO:0030235	Function	Nitric-oxide synthase regulator activity	EXP	9580552, 10781589
GO:0030235	Function	Nitric-oxide synthase regulator activity	IDA	15937123
GO:0030235	Function	Nitric-oxide synthase regulator activity	IEA
GO:0030911	Function	TPR domain binding	IDA	9660753
GO:0030911	Function	TPR domain binding	TAS	12526792
GO:0031396	Process	Regulation of protein ubiquitination	IDA	16809764
GO:0031396	Process	Regulation of protein ubiquitination	IEA
GO:0031526	Component	Brush border membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16207813
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	TAS	19740745
GO:0032273	Process	Positive regulation of protein polymerization	IDA	19363271
GO:0032564	Function	DATP binding	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	20628368
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032880	Process	Regulation of protein localization	ISS
GO:0032991	Component	Protein-containing complex	IBA
GO:0032991	Component	Protein-containing complex	IDA	23349634
GO:0032991	Component	Protein-containing complex	IEA
GO:0034605	Process	Cellular response to heat	IBA
GO:0034605	Process	Cellular response to heat	IEA
GO:0034774	Component	Secretory granule lumen	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036126	Component	Sperm flagellum	IEA
GO:0042026	Process	Protein refolding	TAS	9660753
GO:0042220	Process	Response to cocaine	IEA
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042802	Function	Identical protein binding	IDA	29127155
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	8289821, 16169070, 21360678, 21460846, 25036637
GO:0042803	Function	Protein homodimerization activity	IDA	29127155
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	16809764
GO:0042981	Process	Regulation of apoptotic process	IDA	25609812
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043202	Component	Lysosomal lumen	TAS	25719862
GO:0043209	Component	Myelin sheath	IBA
GO:0043209	Component	Myelin sheath	IEA
GO:0043254	Process	Regulation of protein-containing complex assembly	NAS	20176123
GO:0043335	Process	Protein unfolding	NAS	20176123
GO:0043627	Process	Response to estrogen	IEA
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044294	Component	Dendritic growth cone	IEA
GO:0044294	Component	Dendritic growth cone	ISS
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	ISS
GO:0045732	Process	Positive regulation of protein catabolic process	IGI	18292230
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0046209	Process	Nitric oxide metabolic process	TAS
GO:0046677	Process	Response to antibiotic	ISS
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	IPI	19363271
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050821	Process	Protein stabilization	IBA
GO:0050821	Process	Protein stabilization	IMP	27353360
GO:0051020	Function	GTPase binding	IPI	24337748
GO:0051022	Function	Rho GDP-dissociation inhibitor binding	IEA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	15644312
GO:0051131	Process	Chaperone-mediated protein complex assembly	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IEA
GO:0061684	Process	Chaperone-mediated autophagy	TAS	25719862
GO:0070062	Component	Extracellular exosome	HDA	11487543, 12519789, 19199708, 20458337, 23533145
GO:0070182	Function	DNA polymerase binding	IEA
GO:0070182	Function	DNA polymerase binding	IPI	10197982, 19751963
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0097110	Function	Scaffold protein binding	IPI	10409742
GO:0097226	Component	Sperm mitochondrial sheath	IEA
GO:0097524	Component	Sperm plasma membrane	IEA
GO:0097718	Function	Disordered domain specific binding	IEA
GO:0097718	Function	Disordered domain specific binding	IPI	15713458
GO:0098586	Process	Cellular response to virus	IDA	25609812
GO:0099072	Process	Regulation of postsynaptic membrane neurotransmitter receptor levels	IEA
GO:0101031	Component	Protein folding chaperone complex	IDA	25719862
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:0140767	Function	Enzyme-substrate adaptor activity	EXP	11988487, 12799359
GO:1902988	Process	Neurofibrillary tangle assembly	IDA	19363271
GO:1904813	Component	Ficolin-1-rich granule lumen	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905323	Process	Telomerase holoenzyme complex assembly	IDA	10197982
GO:1905323	Process	Telomerase holoenzyme complex assembly	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	20353823

Other IDs

• MIM: 140571
• HGNC: 5253
• e!Ensembl: ENSG00000080824

Protein

• UniProt ID: P07900
• Protein name: Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Heat shock protein family C member 1) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38)
• Protein function: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its AT
• PDB: 1BYQ , 1OSF , 1UY6 , 1UY7 , 1UY8 , 1UY9 , 1UYC , 1UYD , 1UYE , 1UYF , 1UYG , 1UYH , 1UYI , 1UYK , 1UYL , 1YC1 , 1YC3 , 1YC4 , 1YER , 1YES , 1YET , 2BSM , 2BT0 , 2BUG , 2BYH , 2BYI , 2BZ5 , 2C2L , 2CCS , 2CCT , 2CCU , 2FWY , 2FWZ , 2H55 , 2JJC , 2K5B , 2QF6 , 2QFO , 2QG0 , 2QG2 , 2UWD , 2VCI , 2VCJ , 2WI1 , 2WI2 , 2WI3 , 2WI4 , 2WI5 , 2WI6 , 2WI7 , 2XAB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00183	HSP90	196 → 723	Hsp90 protein	Family
  PF02518	HATPase_c	40 → 194	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain

• Sequence:

  MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
  YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
  ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
  GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
  KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
  PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
  IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
  LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
  CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
  LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
  TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
  DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
  GDDDTSRMEEVD

• Sequence length: 732

Pathways

KEGG Pathway	Reactome Pathway
Protein processing in endoplasmic reticulum	Signaling by ERBB2
PI3K-Akt signaling pathway	Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
Necroptosis	Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation
Antigen processing and presentation	vRNP Assembly
NOD-like receptor signaling pathway	Regulation of actin dynamics for phagocytic cup formation
IL-17 signaling pathway	eNOS activation
Th17 cell differentiation	Regulation of PLK1 Activity at G2/M Transition
Progesterone-mediated oocyte maturation	Scavenging by Class F Receptors
Estrogen signaling pathway	HSP90 chaperone cycle for steroid hormone receptors (SHR)
Salmonella infection	HSF1 activation
Pathways in cancer	Attenuation phase
Chemical carcinogenesis - receptor activation	HSF1-dependent transactivation
Prostate cancer	Loss of Nlp from mitotic centrosomes
Lipid and atherosclerosis	Recruitment of mitotic centrosome proteins and complexes
Fluid shear stress and atherosclerosis	Loss of proteins required for interphase microtubule organization from the centrosome
	Recruitment of NuMA to mitotic centrosomes
	Sema3A PAK dependent Axon repulsion
	VEGFA-VEGFR2 Pathway
	VEGFR2 mediated vascular permeability
	Uptake and function of diphtheria toxin
	Anchoring of the basal body to the plasma membrane
	Constitutive Signaling by EGFRvIII
	Interleukin-4 and Interleukin-13 signaling
	Neutrophil degranulation
	The role of GTSE1 in G2/M progression after G2 checkpoint
	AURKA Activation by TPX2
	Downregulation of ERBB2 signaling
	ESR-mediated signaling
	Extra-nuclear estrogen signaling
	Estrogen-dependent gene expression
	Constitutive Signaling by Overexpressed ERBB2
	Drug-mediated inhibition of ERBB2 signaling
	Signaling by ERBB2 KD Mutants
	Resistance of ERBB2 KD mutants to trastuzumab
	Resistance of ERBB2 KD mutants to sapitinib
	Resistance of ERBB2 KD mutants to tesevatinib
	Resistance of ERBB2 KD mutants to neratinib
	Resistance of ERBB2 KD mutants to osimertinib
	Resistance of ERBB2 KD mutants to afatinib
	Resistance of ERBB2 KD mutants to AEE788
	Resistance of ERBB2 KD mutants to lapatinib
	Signaling by ERBB2 ECD mutants
	Signaling by ERBB2 TMD/JMD mutants
	Drug resistance in ERBB2 TMD/JMD mutants

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BREAST NEOPLASMS	—	CTD	20562527	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	25724174	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (488)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	25665180		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	29396434		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12886242, 26416354, 26443624		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30536958		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	23874879, 25075042, 27829290, 30930968		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	25075042, 31527404		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19451690, 20952506, 26517240, 27880046, 30154228, 31370342		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30844069		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26320184		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	30315857		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12970299, 14709792, 25682284, 28458565, 31402210		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	30315857, 31561992		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	31561992	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26443624		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30143009		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19805107		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17671417, 24109220, 31765670		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30315857, 31379752		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	24850175	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19072283, 30611996, 36159817, 37438770	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22769591	Inhibit	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	27457810		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28559789		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	36114006, 37682161	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	15358145		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	28215707	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28215707		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12972407		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	25205676, 29875144	Associate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	27826093		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29044146		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30801702		★☆☆☆☆ Found in Text Mining only
Anophthalmos	Syndromic microphthalmia	BEFREE	17397257		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	19155198		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	31856737	Inhibit	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30315857, 31379752		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	39252332	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20154064, 24650873, 28337290		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15529360		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10225814, 27448590	Associate	★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	28638734		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11677765, 28584561		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	33469081	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20154064, 24650873, 28337290		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35091448	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23293352, 29849874, 33196989	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23293352, 23936217, 30629603, 31824497		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	22706881		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27864821, 29396434, 30127907, 30127994, 30143009		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	23458665		★☆☆☆☆ Found in Text Mining only
Barakat syndrome	Hypoparathyroidism-deafness-renal disease syndrome	BEFREE	23720234		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	22901192, 35709760	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	27226232	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	12970299, 14709792		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	22745766		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	23874684	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	23874684		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	32871949, 35821008	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23401075, 24784839, 28298630, 29317342, 29930380, 31645902		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	23190580		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	33196989	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28522336		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16968971		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33469081	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	19244114		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	26480821		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10513983, 11489796, 12709419, 15862952, 16144943, 1735610, 17487411, 18957107, 19014541, 19277710, 19855434, 20847343, 20920318, 21558407, 21795853, 21821931, 22445681, 22510516, 22521890, 23065205, 23228483, 23456764, 24384723, 24705874, 24706460, 25227799, 25489079, 25579569, 26416354, 26556856, 26916007, 27259689, 27268613, 27796714, 28051275, 28111726, 28529458, 28801701, 28914785, 28993342, 29235516, 29396630, 29416003, 29437790, 29491085, 29717218, 30138434, 30827868, 30837677, 30917858, 31336913, 31493740, 31522240, 31660083, 31801945, 31808979		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	20562527		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12177805, 18785742, 19014541, 19277710, 19416831, 19738418, 20226014, 20602789, 20650008, 20847343, 20883729, 20920318, 20946630, 21670086, 21821931, 22510516, 22701533, 23228483, 23613388, 24466266, 24927996, 25159299, 25227799, 26553005, 27268613, 27863425, 28051275, 28914785, 29178343, 29618179, 30837677, 31101846, 31163701, 31493740, 32358373, 33145341, 33388604, 33672529, 34636027, 35053185, 35864548, 36323529, 36395883, 36882618, 38263419, 39187325, 39780215, 40724844, 8878452	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	34708717	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37731021	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	25106706		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	16644868, 17185503, 23364790		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	23936217		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	16056252, 28064214, 37569852	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28064214, 28619753, 30453475		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	21498475		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	17094460	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10851351, 19138996, 23570868, 25263741, 26082332, 28032595, 28637869, 28914785, 29875144, 31684108, 37606138	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	24100469	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23874879, 24733427, 26872308, 29061812		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26502919	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33145341	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20602789, 20691061, 34708717	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20602789, 20691061	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15810071, 19514085, 19682504, 20170530, 20480028, 25955495, 26980196, 27831650, 29321577, 34884975, 35398623, 35504805, 35892599, 36292719, 37717471, 39342037, 39509399	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26704341	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	19738418	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	20602789	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	20691061	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23401075, 24784839, 28298630, 29317342, 29930380, 31645902		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18520302, 19176399, 22592212, 23012248, 24530475, 24952482, 25374192, 25607753, 26219569, 27688186, 28288818, 28678347, 29207057, 29298657, 29339250, 30021337, 30257315, 31431614		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28284058	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17346426, 22172030, 26804907, 36932108	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	18677112	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19142186	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27356570, 37347115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22433057, 23135731, 23900136, 30929564, 31175180		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29912636		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27711126	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16247757		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	16247757		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29849874	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29849874		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	35778717	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39736019	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19458065, 29228626		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	19458065, 29228626		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26443624		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19805107		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30067876, 31054213		★☆☆☆☆ Found in Text Mining only
Chondroma	Chordoma	Pubtator	11079732	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	23063503		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31178953		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15972449, 18768392, 20351313, 20738310, 22619113, 23458665, 26397138, 26556860, 27107422, 28114285, 31726100		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	16300468		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	36159817	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23321985		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22297444, 33299870, 39252247	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18977205, 21129190, 24733427, 24962213, 25444464, 26416450, 26832792, 27391062, 28302086, 28583846, 28789442, 30920570, 31199053, 31213460, 31244417, 31708688		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16774932		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20617406, 22451720, 24733427	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	34827586	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22613625, 23838996, 23852390, 24861206, 25210794, 25296971, 25444464, 25446253, 25982393, 27494878, 28255900, 28870917, 29939072, 30708039, 31375671, 31555737, 31655629, 31687275, 31715300, 31801945		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12177805, 15457556, 18931700, 20558745, 23386606, 24733427, 24962213, 25444464, 25446253, 25982393, 27391062, 28302086, 33065966, 33866334, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18497978		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35590292	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	23874684		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	22810956, 29113809		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	25031753	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	25724174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27845047		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38097358	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22749932	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22749932		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	28440609		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20089831		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	20089831, 20534503	Associate	★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	29875161		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16139532		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	35327643	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	20047716, 29658791, 29893552		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	35821008	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	23936217, 27659253		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	25652452, 29434648, 29474750, 30629603		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33890634	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19494268	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25652452, 29434648, 29474750, 30629603, 31778773		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35650387, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24689038, 32851081, 35091448	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12753809, 12791317, 26397425, 28190264, 30629603		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29752628		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	35091448	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26156684, 33274236, 40214234	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	19036086, 21041953, 26142707, 30143009		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30679388		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	30788006		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28336260		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	19277710	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35227068	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	24850175	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23538402, 24853175, 30925862		★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex	Epidermolysis Bullosa Simplex	BEFREE	20151404		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28028152, 30450970		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22433057, 31175180		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23064324, 24589738		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23064324, 24589738		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24817950, 29665050, 32662828, 34294701	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	19013896		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Familial dilated cardiomyopathy	Cardiomyopathy	BEFREE	16247757		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	17327415		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	17327415, 17881891, 22537224		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	22869732, 28215707	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	17327415, 17881891, 22537224		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	26651243, 30659446		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28412732		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	14606110	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19047110, 20546334, 21737509, 21825009, 27379708, 30679388, 31458497, 31776458		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	LHGDN	19047110		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	23584476	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	25583479		★☆☆☆☆ Found in Text Mining only
Genitourinary Neoplasms	Genitourinary Neoplasms	LHGDN	17088927		★☆☆☆☆ Found in Text Mining only
Gingival Diseases	Gingival diseases	Pubtator	33934404	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	29263415		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19244114, 20643786, 22913813, 25202074, 28035139, 28679777, 28765916, 28915577, 29593424, 30639261, 30647839		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21127066, 21408136, 23201460, 28424411	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18682579, 19244114, 20643786, 22913813, 25202074, 28035139, 28424411, 28679777, 28765916, 28915577, 29593424, 30639261, 30647839		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16968971, 20007406, 28679777, 29088865		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33469081, 35697672, 39780215	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	16603618	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	19657113	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	28246193		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33613444	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24336076, 28143445		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26293741, 29768689	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	31941532	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35645616, 37092838	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28078663		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	20977755	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23966620, 26743233		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	24817950	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	17393177, 30800680, 31684904		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22898980	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	34685577	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	22510516	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18957107, 20602789	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	27742706		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27870927, 35572591	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24381308, 26731018, 31361762, 31600883		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	31361762	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	24650873		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30629603, 31676796		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31676796	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	33196989	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Malignant	Malignant hypertension	Pubtator	10048123	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31346611		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30205637		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	23720234		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19383717, 20668552	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35043517	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	22926076		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25795136, 29394093		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28182573, 28239659		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22297444	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23321985, 31717769		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17563366, 33274236	Associate	★☆☆☆☆ Found in Text Mining only
Insulin resistance - type A	Insulin resistance syndrome	BEFREE	17563366		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	31124977	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23874879	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30067876		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	40594501	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23209418		★☆☆☆☆ Found in Text Mining only
Kaufman-McKusick syndrome	Kaufman-McKusick Syndrome	BEFREE	18094050		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	CTD_human_DG	17157164		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	17610208, 27870927		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30508278		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25308700		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	27206740	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	27353360		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	17346426, 27353360, 39780215	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28269752	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	20546334		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10076566, 11895790, 12738674, 18591380, 20533075, 20694586, 22898820, 28036294, 28715732, 32397330, 38057328	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11895790, 14555522, 20651072, 21346199, 25161239, 29348817, 30866043		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	29651431	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15784732, 18386162, 18394702, 18591380, 24885082, 27802968, 32397330, 33284559, 39251712	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	30536958	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	29228628		★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	27742706		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11587362, 18373709, 20890793, 22150087, 23155442, 24849514, 24885082, 27802968, 28713903, 29100024, 29748445, 30344940, 30953928		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18386162		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17671417, 24109220, 31765670		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30741686		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	30741686	Associate	★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	27467582		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18820283		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	26225840, 29061812		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	26225840		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14985104, 16216419, 16317707, 17627933, 19085954, 19514085, 21846483, 25862856, 25955495, 26351876, 26704341, 27909289, 28915577, 29262861, 30483734, 30488605, 30521791, 31105855, 31567483, 31785857		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	36246566	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	40004184	Associate	★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Long QT Syndrome	BEFREE	23963841		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	21998300, 32457348	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28239659		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	23400887, 27448590	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29968330		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18320023		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18645008, 19176399, 25374192, 26219569, 26517240, 27356570, 29529211, 30477473, 31569342, 32457348, 34721827, 35522136, 39518920	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10447736, 15818685, 36482627, 37072752	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	1335295, 9003407	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	1335295, 15818685, 30149120, 7605872, 8216691, 9872476		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	14606110, 37547757	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20847343, 23638161	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23874879	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	26416354		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12842893, 17085670, 22681779, 22751135, 28300840		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	14655758, 16056252, 22681779, 35572591	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	20133897		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	20133771, 27107422, 29228628		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	24477711		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30946360, 34202702, 34629418	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21907973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	28679777		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24336076, 28143445		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	21106982, 21139584, 27742706, 30115641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	16968971		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10513983, 11489796, 12709419, 15862952, 16144943, 1735610, 17487411, 19014541, 19277710, 19855434, 20847343, 20920318, 21558407, 21795853, 21821931, 22445681, 22510516, 22521890, 23065205, 23228483, 23456764, 24384723, 24705874, 24706460, 24903226, 25227799, 25449780, 25489079, 25579569, 26416354, 26556856, 26916007, 27259689, 27268613, 27796714, 27863425, 28051275, 28111726, 28529458, 28801701, 28914785, 28993342, 29235516, 29396630, 29416003, 29437790, 29491085, 29717218, 30138434, 30528977, 30827868, 30837677, 30963174, 31336913, 31493740, 31522240, 31660083, 31801945, 31808979		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	20562527		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23538402, 30925862		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23064324, 24589738		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28412732		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22287729, 28980313, 8528482		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	22470109		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18520302, 19176399, 22552292, 22592212, 23012248, 24530475, 24952482, 25374192, 25607753, 26219569, 27688186, 28288818, 29207057, 29298657, 29339250, 30021337, 30257315, 31431614		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18820283		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	21498475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23135731, 23900136, 30929564		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18253734, 18852131, 21129190, 21470770, 21875325, 22287729, 26682870, 27779106, 27878398, 28841232, 29691700, 30801702, 30980109, 31121848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11980636, 14571418, 17974989, 18954528, 21125667, 22573351, 22899854, 22989880, 23152004, 23674566, 25176024, 25241147, 25604133, 26187127, 27197266, 28350865, 29391407, 30467317, 30992362, 31113841, 31135075		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19569046, 22287729, 22531355, 23395886, 24070739, 29743591, 30591093, 30598339, 30745823, 31596953		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	28512265		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12843186, 31812782		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23401075, 24784839, 28298630, 29317342, 29930380, 31217782, 31645902		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15106614, 15613472, 15661534, 15809267, 16644868, 16647200, 17185503, 17487411, 17513464, 17517623, 17624530, 17881891, 18089825, 18772114, 18931700, 19014541, 19138996, 19223869, 19277710, 19401686, 20231121, 20537126, 20585984, 21037799, 21109931, 21258415, 21566061, 21745565, 21795853, 21811259, 21906632, 21912649, 21949677, 22246317, 22277058, 22315230, 22338602, 22425524, 22492994, 22571616, 22619113, 22669480, 22706881, 22745766, 22824801, 22913813, 23012248, 23069143, 23208072, 23293352, 23355466, 23356585, 23376257, 23418523, 23545047, 23615731, 23658841, 23852390, 24161787, 24185264, 24411988, 25004926, 25167922, 25210794, 25452130, 25503774, 25607753, 25738358, 25855012, 25877301, 26070366, 26561808, 26682870, 26704341, 26802653, 26872972, 26915999, 26916002, 26916003, 26916007, 27197266, 27221337, 27231104, 27422900, 27686857, 27721406, 27793846, 27834134, 27834954, 27880046, 27890930, 27914946, 27922280, 28032595, 28062703, 28073914, 28078663, 28088573, 28103010, 28139075, 28143869, 28153791, 28255900, 28270068, 28336809, 28360912, 28426997, 28429788, 28482218, 28482755, 28533894, 28636940, 28679777, 28713919, 28758577, 28816449, 28844386, 28851842, 28878208, 28910138, 28914774, 28914785, 28915605, 28990809, 28993342, 29121598, 29137866, 29177653, 29177656, 29177665, 29202402, 29203712, 29209046, 29304094, 29321504, 29374167, 29382832, 29392504, 29394093, 29415026, 29438315, 29453286, 29521219, 29541415, 29593424, 29602128, 29618179, 29664615, 29720349, 29749536, 30039622, 30138434, 30158430, 30351001, 30471108, 30485473, 30525599, 30528977, 30670482, 30678647, 30733455, 30745292, 30857829, 30936118, 30957641, 30969015, 30982140, 30982499, 30999048, 31054213, 31105855, 31113013, 31136038, 31163701, 31168612, 31176095, 31200364, 31213460, 31217782, 31244417, 31273033, 31313490, 31411362, 31452440, 31465284, 31501246, 31516744, 31534518, 31560152, 31567483, 31591016, 31592648, 31650359, 31659567, 31662027, 31663736, 31669620, 31687275, 31692039, 31717777, 31726100, 31793427		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19458065		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18977205, 21129190, 24733427, 24962213, 25444464, 26416450, 26832792, 27391062, 28302086, 28583846, 30920570, 31213460, 31244417, 31708688		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	20562527		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12724357, 14526102, 22271573, 26334999, 30963174		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	20562527		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	20562527		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16925576, 21106982, 21139584, 27742706, 30115641		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26254781		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	24483157, 28038712		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19805107		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	33469081, 39251709	Associate	★☆☆☆☆ Found in Text Mining only
Meibomian gland dysfunction	Meibomian Gland Dysfunction	BEFREE	28336260		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	15009113		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15009113, 16371460, 18375819, 19088048, 20546334, 21037799, 21697887, 22351686, 23418523, 23538902, 24398428, 27045471, 27881057, 28440609, 28774796, 29433909, 29481571, 29507054, 29674508, 31659567		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15009113, 18245548		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15344906, 18375819, 20032377, 21037799, 21924824, 22872370, 23418523, 29674508, 32466509, 33904516, 35043517, 35307409, 36113897, 36303457, 37776537, 40135438	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	20047716, 29658791, 29893552		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30585227		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	18827603	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18827603	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	29658585		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27864821		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	16288293, 25189320		★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	26595521		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27367669, 37655754	Associate	★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	10225814	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	21907973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Diseases	Mouth disease	Pubtator	20691061, 36047896	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18820283, 23554211, 29209046	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16234364, 17003370, 17525289, 19748980, 20618338, 20977755, 21871133, 23065523, 24407159, 25485683, 26630652, 28512265, 34600510, 35264575, 39873160	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16923571		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17906076, 21871133, 22351691, 23065523, 23246572, 24824351, 28873084, 31244417, 31650359		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	1374907	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	1374907, 18573821		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	32923112	Stimulate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	16056252	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23047954	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	20651072, 21745565		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17671436, 20675402, 23190580, 24206096, 28036294, 29219946, 29724897, 30822403		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30582930		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	26225840, 26595521		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21498475, 30882922, 31634779		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21498475, 29582644, 31634779, 37172717, 37217794, 38212344	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10786689, 11489796, 12825852, 12970299, 14529387, 14529390, 14657666, 15107611, 15539946, 16061682, 16371460, 16432177, 16647200, 16982765, 17016641, 17513464, 18199556, 18320023, 19036086, 19229106, 19451690, 19458065, 19502802, 19514085, 19734938, 19805107, 19855434, 20351313, 20502461, 20643786, 20664927, 20841485, 20920318, 21109931, 21129190, 21258415, 21502504, 21737488, 21811259, 22195560, 22246317, 22277058, 22669480, 22912387, 23065523, 23209418, 23376257, 23456764, 23533265, 23545047, 23615731, 23874879, 23886587, 24121490, 24185264, 24327273, 24338924, 24411988, 24733427, 24853175, 24903226, 25185500, 25444464, 25444911, 25670862, 25854583, 26070366, 26143116, 26416450, 26916007, 27259689, 27353360, 27779106, 27845047, 27880046, 28038472, 28043142, 28209383, 28291803, 28387662, 28412732, 28453558, 28617974, 28619753, 28619760, 28638734, 28717943, 28765916, 28870917, 28928431, 28980313, 29061812, 29100402, 29177656, 29203709, 29255093, 29262632, 29262861, 29317342, 29383696, 29438315, 29481571, 29491085, 29627724, 29651431, 29665050, 29691700, 29749536, 30017966, 30072489, 30087438, 30115641, 30158430, 30176876, 30210681, 30420201, 30488605, 30727894, 30730850, 30739912, 30794824, 30809293, 30858416, 31175180, 31347053, 31449053, 31516744, 31519378, 31560152, 31645902, 31655430, 31687275		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	16509931, 31178953		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20651072		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30508278		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	16603618	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	27769261	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	22926076		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11394871, 19734938, 21109931, 31692039		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18036348, 18797883, 19734938, 21109931, 24293393	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26405178, 31141217, 37515325	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16644868, 17185503, 17517623, 24477711, 25147790, 25308700, 27457810, 28429788, 28559789, 28758577, 28844386, 29137866, 29177653, 29311797, 30158430, 30232754, 31600883, 31663736, 31793427, 31816334, 31824256		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	26965582, 30730850, 31638190		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	15927533, 30792306		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	30882922		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28902428, 31534518		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16024644, 18320023, 21258415, 23012248, 23069143, 23493311, 23515752, 23533265, 24471765, 24511009, 24530475, 24789511, 24952482, 25077897, 25117641, 25185500, 25607753, 25662161, 25855012, 26036303, 26517240, 26723875, 27362807, 27770383, 28081601, 28167505, 28274158, 28315949, 28797845, 29061506, 29247830, 29436674, 29521219, 29561705, 29567459, 30224681, 30365122, 30471108, 30796972, 30867003, 30930968, 31446981, 31527404, 31555510, 31802936		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24986468	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31336120		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31885746	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22510516, 25489079		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16139532	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29344651	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29658585		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23027359, 35069780	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23063503, 23208072, 28681940, 28915577, 30153855, 30982140, 31595984		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30929564		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16815388	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23135731, 23900136		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12177805, 26134508, 28757353, 31540229, 33167494, 35464051, 37259027	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18253734, 18852131, 21129190, 21470770, 21875325, 22287729, 22843495, 26682870, 27779106, 27878398, 28841232, 29691700, 30801702, 30980109, 31121848		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17975158		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	18253734		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10851351, 30980109, 35628341	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25031753	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	36671463	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14621192, 1493372, 22151618		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	24109220	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19027885, 30463061	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28758577, 29471019, 30341316, 30400118, 30463061, 30741686, 31600883		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30741686	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	23936217	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	23936217		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	14668798		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12970299, 14709792, 25682284, 31402210		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	25877301, 29401581		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31589841		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38256230	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21907973, 29893552		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22271575		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26416354		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30038221		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	20156737		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11980636, 14571418, 17974989, 18954528, 21125667, 22573351, 22899854, 22989880, 23152004, 23674566, 25176024, 25241147, 25604133, 26187127, 27197266, 28350865, 29391407, 30467317, 30992362, 31113841, 31135075		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17094460	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	18695913		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16449656, 17094460, 17221841, 18726985, 19809428, 22315230, 22989880, 24606454, 25939977, 29391407, 29632047, 36672148, 36982267, 39780215	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18089825, 22573351, 24338924, 25670862		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	23202271, 24521827, 27864821		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27627558, 36072642, 37753829	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29394093		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27769261, 34449539, 38641747	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28182573, 28239659, 28478401		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	22470109		★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	BEFREE	23720234		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	23720234		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31128915		★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	28638734		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	20817636		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23900261, 8078944		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19826195	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	24098578		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	37296184	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29968330, 30304567, 30465159		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	26391399	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	20546334, 26044951		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36495678	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	22687408	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19110265		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28414930		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33414495	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	25444464		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	25244257	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29180187, 29393970		★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	11677765		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	33414495	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	16449656		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30577726		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	17957250	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	18520302, 27922280, 28453558, 28987383, 29594044, 30257981		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	20552022, 26464709	Associate	★☆☆☆☆ Found in Text Mining only
Small vessel vasculitis	Small vessel vasculitis	BEFREE	17393177		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	29259622		★☆☆☆☆ Found in Text Mining only
Spinocerebellar ataxia 14	Spinocerebellar Ataxia	BEFREE	30093405		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	27058144		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17016641, 30930968		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19142186		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28387662, 28454329, 29331417, 31413593		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29768689, 34928263, 36200687, 37547757	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28143445, 29121598, 29297949		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19569046, 22287729, 22531355, 23395886, 24070739, 29743591, 30591093, 30598339, 30745823, 31596953		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	14606110, 19203381, 22531355, 23638161, 26646027, 27644641, 30591093, 37474578, 37794689	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	39736019	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30459553		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	23661493		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28360912		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	17304350, 17517623, 23999428, 29311797		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	17304350		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	16449656	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	24398328		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35938548	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12843186, 14621192, 31812782		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	12843186, 14621192, 31812782		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19958949, 26542767	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22510516, 24705874, 30678647, 32358373, 32895397, 38179762	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24346128, 24705874, 27796714, 28529458, 28849241, 29097911, 29262632, 29436674, 30039622, 30210681, 30528977, 30678647, 30703411, 30827868, 30867138		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22749932, 31168612		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	14621192		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	21907973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12942564, 24718854, 28298630, 32608202	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	40352921	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21909374, 22132102, 32151082, 34784845, 35043518, 37329997, 37400149, 37606138, 40352921, 40446016	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18245548, 30211813		★☆☆☆☆ Found in Text Mining only
VACTERL association	Vacterl association	Pubtator	30887706	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	28550115		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	15992426		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	18692595		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	27627558, 34199261	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30800680		★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	30887706	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	39302489	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33790887	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25485683	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis Cerebrotendinous	Xanthomatosis	Pubtator	39557107	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	29953987		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CRHBP 2 shared diseasesDepression, Mood disorder 2 shared evidence sourcesDisgenet (Depression), Disgenet (Mood disorder) Related via 2 shared diseases including Depression, Mood disorder — evidence mostly Disgenet. DAO 2 shared diseasesDepression, Mood disorder 2 shared evidence sourcesDisgenet (Depression), Disgenet (Mood disorder) Related via 2 shared diseases including Depression, Mood disorder — evidence mostly Disgenet. CLOCK 2 shared diseasesDepression, Mood disorder 2 shared evidence sourcesDisgenet (Depression), Disgenet (Mood disorder) Related via 2 shared diseases including Depression, Mood disorder — evidence mostly Disgenet. DAOA 2 shared diseasesDepression, Mood disorder 2 shared evidence sourcesDisgenet (Depression), Disgenet (Mood disorder) Related via 2 shared diseases including Depression, Mood disorder — evidence mostly Disgenet. CREB1 2 shared diseasesDepression, Mood disorder 4 shared pathwaysAntigen processing and presentation, Estrogen signaling pathway, Chemical carcinogenesis - receptor activation, Prostate cancer 2 shared evidence sourcesDisgenet (Depression), Disgenet (Mood disorder) Related via 4 shared pathways including Antigen processing and presentation, Estrogen signaling pathway — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CRHBP	2	["Depression","Mood disorder"]	0	[]	2	["Disgenet (Depression)","Disgenet (Mood disorder)"]
DAO	2	["Depression","Mood disorder"]	0	[]	2	["Disgenet (Depression)","Disgenet (Mood disorder)"]
CLOCK	2	["Depression","Mood disorder"]	0	[]	2	["Disgenet (Depression)","Disgenet (Mood disorder)"]
DAOA	2	["Depression","Mood disorder"]	0	[]	2	["Disgenet (Depression)","Disgenet (Mood disorder)"]
CREB1	2	["Depression","Mood disorder"]	4	["Antigen processing and presentation","Estrogen signaling pathway","Chemical carcinogenesis - receptor activation","Prostate cancer"]	2	["Disgenet (Depression)","Disgenet (Mood disorder)"]

Diseases Linked via Similar Genes

Bipolar disorder Linked via 4 of 5 related genesDAO, CLOCK, DAOA, CREB1 Schizophrenia Linked via 4 of 5 related genesDAO, CLOCK, DAOA, CREB1 Alzheimer disease Linked via 2 of 5 related genesDAO, CLOCK Hepatocellular carcinoma Linked via 1 of 5 related genesCRHBP Amyotrophic lateral sclerosis Linked via 1 of 5 related genesDAO

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Bipolar disorder	4	["DAO","CLOCK","DAOA","CREB1"]
Schizophrenia	4	["DAO","CLOCK","DAOA","CREB1"]
Alzheimer disease	2	["DAO","CLOCK"]
Hepatocellular carcinoma	1	["CRHBP"]
Amyotrophic lateral sclerosis	1	["DAO"]