CREB1 (cAMP responsive element binding protein 1)

Gene

• Entrez ID: 1385
• Gene name: CAMP responsive element binding protein 1
• Gene symbol: CREB1
• Synonyms (NCBI Gene): CREB, CREB-1
• Chromosome: 2
• Chromosome location: 2q33.3
• Summary: This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000066	hsa-miR-34b-5p	Review, Luciferase reporter assay	19461653
MIRT004766	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, Western blot	20886090
MIRT000066	hsa-miR-34b-5p	Luciferase reporter assay, qRT-PCR, Western blot	19258499
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006496	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR	21707582
MIRT006496	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR	21707582
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006273	hsa-miR-182-5p	GFP reporter assay	22325466
MIRT006496	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR	21707582
MIRT006496	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR	21707582
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23546867
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT007342	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23543137
MIRT023389	hsa-miR-122-5p	Microarray	17612493
MIRT053489	hsa-miR-181b-5p	GFP reporter assay, qRT-PCR, Western blot	22539488
MIRT053793	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	23185366
MIRT054313	hsa-miR-27b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25825983
MIRT054313	hsa-miR-27b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25825983
MIRT007342	hsa-miR-200b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25825983
MIRT007342	hsa-miR-200b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25825983
MIRT020342	hsa-miR-34b-3p	Microarray, QRTPCR, Western blot	24816316
MIRT054924	hsa-miR-33b-5p	Luciferase reporter assay, qRT-PCR	23716591
MIRT437867	hsa-miR-19b-3p	qRT-PCR	23433743
MIRT205045	hsa-miR-17-5p	qRT-PCR	23433743
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT508601	hsa-miR-4643	HITS-CLIP	21572407
MIRT524361	hsa-miR-1183	HITS-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508599	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT524357	hsa-miR-567	HITS-CLIP	21572407
MIRT508598	hsa-miR-466	HITS-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT524347	hsa-miR-3924	HITS-CLIP	21572407
MIRT524346	hsa-miR-297	HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT508601	hsa-miR-4643	HITS-CLIP	21572407
MIRT524361	hsa-miR-1183	HITS-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT524357	hsa-miR-567	HITS-CLIP	21572407
MIRT508598	hsa-miR-466	HITS-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT524347	hsa-miR-3924	HITS-CLIP	21572407
MIRT524346	hsa-miR-297	HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT508601	hsa-miR-4643	HITS-CLIP	23313552
MIRT524361	hsa-miR-1183	HITS-CLIP	23313552
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508598	hsa-miR-466	HITS-CLIP	23313552
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT524347	hsa-miR-3924	HITS-CLIP	23313552
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT508601	hsa-miR-4643	HITS-CLIP	23313552
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508599	hsa-miR-656-3p	HITS-CLIP	23313552
MIRT508598	hsa-miR-466	HITS-CLIP	23313552
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT668912	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT668911	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT668910	hsa-miR-4760-3p	HITS-CLIP	23824327
MIRT668909	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT668908	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT668907	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT668906	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT524371	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT668905	hsa-miR-5696	HITS-CLIP	23824327
MIRT668904	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT668903	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT668902	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT668901	hsa-miR-4263	HITS-CLIP	23824327
MIRT668900	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT524361	hsa-miR-1183	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508599	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT524357	hsa-miR-567	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT524347	hsa-miR-3924	PAR-CLIP	21572407
MIRT524346	hsa-miR-297	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508599	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508599	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT205046	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT205057	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT205048	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT205050	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT205055	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT205045	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT205053	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT205047	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT524389	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT524388	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT524387	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT524386	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT524385	hsa-miR-302e	PAR-CLIP	23446348
MIRT524384	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT524383	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT524382	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT524381	hsa-miR-520b	PAR-CLIP	23446348
MIRT524380	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT524379	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT524378	hsa-miR-520e	PAR-CLIP	23446348
MIRT524376	hsa-miR-4438	PAR-CLIP	23446348
MIRT524377	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT524375	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT524374	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT524373	hsa-miR-520h	PAR-CLIP	23446348
MIRT524372	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT524371	hsa-miR-519d-5p	PAR-CLIP	23446348
MIRT524370	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT524369	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT524368	hsa-miR-4252	PAR-CLIP	23446348
MIRT524367	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT524365	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT524366	hsa-miR-5095	PAR-CLIP	23446348
MIRT524364	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT524363	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT524362	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT508601	hsa-miR-4643	PAR-CLIP	23446348
MIRT524361	hsa-miR-1183	PAR-CLIP	23446348
MIRT524360	hsa-miR-300	PAR-CLIP	23446348
MIRT524359	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT524358	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508599	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT524357	hsa-miR-567	PAR-CLIP	23446348
MIRT508598	hsa-miR-466	PAR-CLIP	23446348
MIRT524356	hsa-miR-376a-5p	PAR-CLIP	23446348
MIRT524355	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT524354	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT524353	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT524352	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT524351	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524350	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT524349	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT524348	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT524347	hsa-miR-3924	PAR-CLIP	23446348
MIRT524346	hsa-miR-297	PAR-CLIP	23446348
MIRT524345	hsa-miR-4760-5p	PAR-CLIP	23446348
MIRT524344	hsa-miR-8061	PAR-CLIP	23446348
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT508601	hsa-miR-4643	PAR-CLIP	23446348
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508599	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT508598	hsa-miR-466	PAR-CLIP	23446348
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT119391	hsa-miR-3606-3p	PAR-CLIP	22291592
MIRT119386	hsa-miR-513a-3p	PAR-CLIP	22291592
MIRT119389	hsa-miR-513c-3p	PAR-CLIP	22291592
MIRT498183	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT498182	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT498181	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT498180	hsa-miR-5194	PAR-CLIP	22291592
MIRT498179	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT498178	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT086927	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT498177	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT498176	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT498175	hsa-miR-578	PAR-CLIP	22291592
MIRT086929	hsa-miR-433-3p	Luciferase reporter assay	26844702
MIRT086929	hsa-miR-433-3p	Luciferase reporter assay	26844702
MIRT731575	hsa-miR-204-5p	Luciferase reporter assay	27046651
MIRT731575	hsa-miR-204-5p	Luciferase reporter assay	27046651
MIRT054313	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27809310
MIRT054313	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27809310
MIRT732195	hsa-miR-582-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26978739
MIRT732195	hsa-miR-582-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26978739
MIRT732195	hsa-miR-582-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26978739
MIRT732195	hsa-miR-582-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26978739
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT732237	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285761
MIRT023389	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337380
MIRT023389	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337380
MIRT023389	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337380
MIRT023389	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	28337380
MIRT733134	hsa-miR-134-5p	qRT-PCR, Western blotting	31625272
MIRT054313	hsa-miR-27b-3p	RNA-seq	31722236
MIRT733343	hsa-miR-22-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32300145
MIRT733344	hsa-miR-26a-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32300145
MIRT733346	hsa-miR-27a-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32300145
MIRT733344	hsa-miR-26a-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32300145
MIRT733348	hsa-miR-221-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32300145
MIRT086929	hsa-miR-433-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34004029
MIRT737127	hsa-miR-1275	qRT-PCR	33910530
MIRT737553	hsa-miR-1290	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32319530
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT508601	hsa-miR-4643	HITS-CLIP	21572407
MIRT524361	hsa-miR-1183	HITS-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508599	hsa-miR-656-3p	HITS-CLIP	21572407
MIRT524357	hsa-miR-567	HITS-CLIP	21572407
MIRT508598	hsa-miR-466	HITS-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT524347	hsa-miR-3924	HITS-CLIP	21572407
MIRT524346	hsa-miR-297	HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	21572407
MIRT508601	hsa-miR-4643	HITS-CLIP	21572407
MIRT524361	hsa-miR-1183	HITS-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT524357	hsa-miR-567	HITS-CLIP	21572407
MIRT508598	hsa-miR-466	HITS-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT524347	hsa-miR-3924	HITS-CLIP	21572407
MIRT524346	hsa-miR-297	HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT508601	hsa-miR-4643	HITS-CLIP	23313552
MIRT524361	hsa-miR-1183	HITS-CLIP	23313552
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508598	hsa-miR-466	HITS-CLIP	23313552
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT524347	hsa-miR-3924	HITS-CLIP	23313552
MIRT508596	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508602	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT508601	hsa-miR-4643	HITS-CLIP	23313552
MIRT508600	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508599	hsa-miR-656-3p	HITS-CLIP	23313552
MIRT508598	hsa-miR-466	HITS-CLIP	23313552
MIRT508597	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT668912	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT668911	hsa-miR-548e-5p	HITS-CLIP	23824327
MIRT668910	hsa-miR-4760-3p	HITS-CLIP	23824327
MIRT668909	hsa-miR-3145-5p	HITS-CLIP	23824327
MIRT668908	hsa-miR-664a-3p	HITS-CLIP	23824327
MIRT668907	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT668906	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT524371	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT668905	hsa-miR-5696	HITS-CLIP	23824327
MIRT668904	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT668903	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT668902	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT668901	hsa-miR-4263	HITS-CLIP	23824327
MIRT668900	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT524361	hsa-miR-1183	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508599	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT524357	hsa-miR-567	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT524347	hsa-miR-3924	PAR-CLIP	21572407
MIRT524346	hsa-miR-297	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508599	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508599	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT508601	hsa-miR-4643	PAR-CLIP	21572407
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508598	hsa-miR-466	PAR-CLIP	21572407
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT205046	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT205057	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT205048	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT205050	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT205055	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT205045	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT205053	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT205047	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT524389	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT524388	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT524387	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT524386	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT524385	hsa-miR-302e	PAR-CLIP	23446348
MIRT524384	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT524383	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT524382	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT524381	hsa-miR-520b	PAR-CLIP	23446348
MIRT524380	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT524379	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT524378	hsa-miR-520e	PAR-CLIP	23446348
MIRT524376	hsa-miR-4438	PAR-CLIP	23446348
MIRT524377	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT524375	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT524374	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT524373	hsa-miR-520h	PAR-CLIP	23446348
MIRT524372	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT524371	hsa-miR-519d-5p	PAR-CLIP	23446348
MIRT524370	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT524369	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT524368	hsa-miR-4252	PAR-CLIP	23446348
MIRT524367	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT524365	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT524366	hsa-miR-5095	PAR-CLIP	23446348
MIRT524364	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT524363	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT524362	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT508601	hsa-miR-4643	PAR-CLIP	23446348
MIRT524361	hsa-miR-1183	PAR-CLIP	23446348
MIRT524360	hsa-miR-300	PAR-CLIP	23446348
MIRT524359	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT524358	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508599	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT524357	hsa-miR-567	PAR-CLIP	23446348
MIRT508598	hsa-miR-466	PAR-CLIP	23446348
MIRT524356	hsa-miR-376a-5p	PAR-CLIP	23446348
MIRT524355	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT524354	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT524353	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT524352	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT524351	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT524350	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT524349	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT524348	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT524347	hsa-miR-3924	PAR-CLIP	23446348
MIRT524346	hsa-miR-297	PAR-CLIP	23446348
MIRT524345	hsa-miR-4760-5p	PAR-CLIP	23446348
MIRT524344	hsa-miR-8061	PAR-CLIP	23446348
MIRT508602	hsa-miR-4789-3p	PAR-CLIP	23446348
MIRT508601	hsa-miR-4643	PAR-CLIP	23446348
MIRT508600	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508599	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT508598	hsa-miR-466	PAR-CLIP	23446348
MIRT508597	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508596	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT119391	hsa-miR-3606-3p	PAR-CLIP	22291592
MIRT119386	hsa-miR-513a-3p	PAR-CLIP	22291592
MIRT119389	hsa-miR-513c-3p	PAR-CLIP	22291592
MIRT498183	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT498182	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT498181	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT498180	hsa-miR-5194	PAR-CLIP	22291592
MIRT498179	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT498178	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT086927	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT498177	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT498176	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT498175	hsa-miR-578	PAR-CLIP	22291592
MIRT755796	hsa-miR-26b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	38597450
MIRT908399	hsa-miR-101	CLIP-seq
MIRT908400	hsa-miR-105	CLIP-seq
MIRT908401	hsa-miR-106a	CLIP-seq
MIRT908402	hsa-miR-106b	CLIP-seq
MIRT908403	hsa-miR-1200	CLIP-seq
MIRT908404	hsa-miR-1227	CLIP-seq
MIRT908405	hsa-miR-1252	CLIP-seq
MIRT908406	hsa-miR-1257	CLIP-seq
MIRT908407	hsa-miR-1258	CLIP-seq
MIRT908408	hsa-miR-125a-3p	CLIP-seq
MIRT908409	hsa-miR-1264	CLIP-seq
MIRT908410	hsa-miR-1271	CLIP-seq
MIRT908411	hsa-miR-1273e	CLIP-seq
MIRT908412	hsa-miR-1278	CLIP-seq
MIRT908413	hsa-miR-128	CLIP-seq
MIRT908414	hsa-miR-1287	CLIP-seq
MIRT908415	hsa-miR-1305	CLIP-seq
MIRT908416	hsa-miR-130a	CLIP-seq
MIRT908417	hsa-miR-130b	CLIP-seq
MIRT908418	hsa-miR-1323	CLIP-seq
MIRT908419	hsa-miR-134	CLIP-seq
MIRT908420	hsa-miR-144	CLIP-seq
MIRT908421	hsa-miR-155	CLIP-seq
MIRT908422	hsa-miR-17	CLIP-seq
MIRT908423	hsa-miR-181a	CLIP-seq
MIRT908424	hsa-miR-181b	CLIP-seq
MIRT908425	hsa-miR-181c	CLIP-seq
MIRT908426	hsa-miR-181d	CLIP-seq
MIRT908427	hsa-miR-182	CLIP-seq
MIRT908428	hsa-miR-186	CLIP-seq
MIRT908429	hsa-miR-199a-3p	CLIP-seq
MIRT908430	hsa-miR-199b-3p	CLIP-seq
MIRT908431	hsa-miR-203	CLIP-seq
MIRT908432	hsa-miR-205	CLIP-seq
MIRT908433	hsa-miR-2053	CLIP-seq
MIRT908434	hsa-miR-20a	CLIP-seq
MIRT908435	hsa-miR-20b	CLIP-seq
MIRT908436	hsa-miR-2355-3p	CLIP-seq
MIRT908437	hsa-miR-25	CLIP-seq
MIRT908438	hsa-miR-2682	CLIP-seq
MIRT908439	hsa-miR-27a	CLIP-seq
MIRT908440	hsa-miR-27b	CLIP-seq
MIRT908441	hsa-miR-28-5p	CLIP-seq
MIRT908442	hsa-miR-301a	CLIP-seq
MIRT908443	hsa-miR-301b	CLIP-seq
MIRT908444	hsa-miR-302a	CLIP-seq
MIRT908445	hsa-miR-302b	CLIP-seq
MIRT908446	hsa-miR-302c	CLIP-seq
MIRT908447	hsa-miR-302d	CLIP-seq
MIRT908448	hsa-miR-3064-3p	CLIP-seq
MIRT908449	hsa-miR-3065-3p	CLIP-seq
MIRT908450	hsa-miR-3074-3p	CLIP-seq
MIRT908451	hsa-miR-3118	CLIP-seq
MIRT908452	hsa-miR-3126-5p	CLIP-seq
MIRT908453	hsa-miR-3129-3p	CLIP-seq
MIRT908454	hsa-miR-3129-5p	CLIP-seq
MIRT908455	hsa-miR-3135b	CLIP-seq
MIRT908456	hsa-miR-3137	CLIP-seq
MIRT908457	hsa-miR-3138	CLIP-seq
MIRT908458	hsa-miR-3139	CLIP-seq
MIRT908459	hsa-miR-3145-3p	CLIP-seq
MIRT908460	hsa-miR-3151	CLIP-seq
MIRT908461	hsa-miR-3153	CLIP-seq
MIRT908462	hsa-miR-3160-5p	CLIP-seq
MIRT908463	hsa-miR-3163	CLIP-seq
MIRT908464	hsa-miR-3164	CLIP-seq
MIRT908465	hsa-miR-32	CLIP-seq
MIRT908466	hsa-miR-3201	CLIP-seq
MIRT908467	hsa-miR-323-5p	CLIP-seq
MIRT908468	hsa-miR-330-3p	CLIP-seq
MIRT908469	hsa-miR-337-3p	CLIP-seq
MIRT908470	hsa-miR-342-3p	CLIP-seq
MIRT908471	hsa-miR-34c-3p	CLIP-seq
MIRT908472	hsa-miR-3611	CLIP-seq
MIRT908473	hsa-miR-3617	CLIP-seq
MIRT908474	hsa-miR-363	CLIP-seq
MIRT908475	hsa-miR-3646	CLIP-seq
MIRT908476	hsa-miR-3647-3p	CLIP-seq
MIRT908477	hsa-miR-3662	CLIP-seq
MIRT908478	hsa-miR-3665	CLIP-seq
MIRT908479	hsa-miR-3666	CLIP-seq
MIRT908480	hsa-miR-367	CLIP-seq
MIRT908481	hsa-miR-3670	CLIP-seq
MIRT908482	hsa-miR-3680	CLIP-seq
MIRT908483	hsa-miR-3685	CLIP-seq
MIRT908484	hsa-miR-3686	CLIP-seq
MIRT908485	hsa-miR-3692	CLIP-seq
MIRT908486	hsa-miR-369-3p	CLIP-seq
MIRT908487	hsa-miR-372	CLIP-seq
MIRT908488	hsa-miR-373	CLIP-seq
MIRT908489	hsa-miR-374a	CLIP-seq
MIRT908490	hsa-miR-374b	CLIP-seq
MIRT908491	hsa-miR-376a	CLIP-seq
MIRT908492	hsa-miR-376b	CLIP-seq
MIRT908493	hsa-miR-376c	CLIP-seq
MIRT908494	hsa-miR-380	CLIP-seq
MIRT908495	hsa-miR-381	CLIP-seq
MIRT908496	hsa-miR-383	CLIP-seq
MIRT908497	hsa-miR-384	CLIP-seq
MIRT908498	hsa-miR-3911	CLIP-seq
MIRT908499	hsa-miR-3934	CLIP-seq
MIRT908500	hsa-miR-3942-5p	CLIP-seq
MIRT908501	hsa-miR-410	CLIP-seq
MIRT908502	hsa-miR-4255	CLIP-seq
MIRT908503	hsa-miR-4262	CLIP-seq
MIRT908504	hsa-miR-4265	CLIP-seq
MIRT908505	hsa-miR-4269	CLIP-seq
MIRT908506	hsa-miR-4270	CLIP-seq
MIRT908507	hsa-miR-4271	CLIP-seq
MIRT908508	hsa-miR-4282	CLIP-seq
MIRT908509	hsa-miR-4295	CLIP-seq
MIRT908510	hsa-miR-4296	CLIP-seq
MIRT908511	hsa-miR-4297	CLIP-seq
MIRT908512	hsa-miR-4305	CLIP-seq
MIRT908513	hsa-miR-4310	CLIP-seq
MIRT908514	hsa-miR-4317	CLIP-seq
MIRT908515	hsa-miR-4322	CLIP-seq
MIRT908516	hsa-miR-4324	CLIP-seq
MIRT908517	hsa-miR-4328	CLIP-seq
MIRT908518	hsa-miR-4419a	CLIP-seq
MIRT908519	hsa-miR-4422	CLIP-seq
MIRT908520	hsa-miR-4434	CLIP-seq
MIRT908521	hsa-miR-4441	CLIP-seq
MIRT908522	hsa-miR-4447	CLIP-seq
MIRT908523	hsa-miR-4457	CLIP-seq
MIRT908524	hsa-miR-4472	CLIP-seq
MIRT908525	hsa-miR-4491	CLIP-seq
MIRT908526	hsa-miR-4495	CLIP-seq
MIRT908527	hsa-miR-449c	CLIP-seq
MIRT908528	hsa-miR-450a	CLIP-seq
MIRT908529	hsa-miR-4510	CLIP-seq
MIRT908530	hsa-miR-4514	CLIP-seq
MIRT908531	hsa-miR-4516	CLIP-seq
MIRT908532	hsa-miR-4525	CLIP-seq
MIRT908533	hsa-miR-4531	CLIP-seq
MIRT908534	hsa-miR-4539	CLIP-seq
MIRT908535	hsa-miR-454	CLIP-seq
MIRT908536	hsa-miR-4637	CLIP-seq
MIRT908537	hsa-miR-4642	CLIP-seq
MIRT908538	hsa-miR-4645-3p	CLIP-seq
MIRT908539	hsa-miR-4646-3p	CLIP-seq
MIRT908540	hsa-miR-4652-3p	CLIP-seq
MIRT908541	hsa-miR-4653-3p	CLIP-seq
MIRT908542	hsa-miR-4657	CLIP-seq
MIRT908543	hsa-miR-4663	CLIP-seq
MIRT908544	hsa-miR-4665-5p	CLIP-seq
MIRT908545	hsa-miR-4666-3p	CLIP-seq
MIRT908546	hsa-miR-4668-3p	CLIP-seq
MIRT908547	hsa-miR-4692	CLIP-seq
MIRT908548	hsa-miR-4699-3p	CLIP-seq
MIRT908549	hsa-miR-4703-3p	CLIP-seq
MIRT908550	hsa-miR-4703-5p	CLIP-seq
MIRT908551	hsa-miR-4705	CLIP-seq
MIRT908552	hsa-miR-4709-5p	CLIP-seq
MIRT908553	hsa-miR-4712-3p	CLIP-seq
MIRT908554	hsa-miR-4712-5p	CLIP-seq
MIRT908555	hsa-miR-4717-3p	CLIP-seq
MIRT908556	hsa-miR-4719	CLIP-seq
MIRT908557	hsa-miR-4723-5p	CLIP-seq
MIRT908558	hsa-miR-4725-3p	CLIP-seq
MIRT908559	hsa-miR-4731-3p	CLIP-seq
MIRT908560	hsa-miR-4742-5p	CLIP-seq
MIRT908561	hsa-miR-4756-3p	CLIP-seq
MIRT908562	hsa-miR-4772-5p	CLIP-seq
MIRT908563	hsa-miR-4777-5p	CLIP-seq
MIRT908564	hsa-miR-4778-3p	CLIP-seq
MIRT908565	hsa-miR-4778-5p	CLIP-seq
MIRT908566	hsa-miR-4786-5p	CLIP-seq
MIRT908567	hsa-miR-4791	CLIP-seq
MIRT908568	hsa-miR-4799-5p	CLIP-seq
MIRT908569	hsa-miR-4800-5p	CLIP-seq
MIRT908570	hsa-miR-4801	CLIP-seq
MIRT908571	hsa-miR-491-3p	CLIP-seq
MIRT908572	hsa-miR-491-5p	CLIP-seq
MIRT908573	hsa-miR-493	CLIP-seq
MIRT908574	hsa-miR-501-5p	CLIP-seq
MIRT908575	hsa-miR-513a-5p	CLIP-seq
MIRT908576	hsa-miR-518d-5p	CLIP-seq
MIRT908577	hsa-miR-519a	CLIP-seq
MIRT908578	hsa-miR-519b-3p	CLIP-seq
MIRT908579	hsa-miR-519b-5p	CLIP-seq
MIRT908580	hsa-miR-519c-3p	CLIP-seq
MIRT908581	hsa-miR-519c-5p	CLIP-seq
MIRT908582	hsa-miR-519d	CLIP-seq
MIRT908583	hsa-miR-520c-5p	CLIP-seq
MIRT908584	hsa-miR-520d-5p	CLIP-seq
MIRT908585	hsa-miR-524-5p	CLIP-seq
MIRT908586	hsa-miR-526a	CLIP-seq
MIRT908587	hsa-miR-539	CLIP-seq
MIRT908588	hsa-miR-543	CLIP-seq
MIRT908589	hsa-miR-544b	CLIP-seq
MIRT908590	hsa-miR-548a-3p	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT908592	hsa-miR-548c-3p	CLIP-seq
MIRT908593	hsa-miR-548e	CLIP-seq
MIRT908594	hsa-miR-548f	CLIP-seq
MIRT908595	hsa-miR-548n	CLIP-seq
MIRT908596	hsa-miR-548o	CLIP-seq
MIRT908597	hsa-miR-548t	CLIP-seq
MIRT908598	hsa-miR-552	CLIP-seq
MIRT908599	hsa-miR-561	CLIP-seq
MIRT908600	hsa-miR-569	CLIP-seq
MIRT908601	hsa-miR-577	CLIP-seq
MIRT908602	hsa-miR-584	CLIP-seq
MIRT908603	hsa-miR-586	CLIP-seq
MIRT908604	hsa-miR-607	CLIP-seq
MIRT908605	hsa-miR-625	CLIP-seq
MIRT908606	hsa-miR-640	CLIP-seq
MIRT908607	hsa-miR-641	CLIP-seq
MIRT908608	hsa-miR-643	CLIP-seq
MIRT908609	hsa-miR-646	CLIP-seq
MIRT908610	hsa-miR-676	CLIP-seq
MIRT908611	hsa-miR-7	CLIP-seq
MIRT908612	hsa-miR-708	CLIP-seq
MIRT908613	hsa-miR-758	CLIP-seq
MIRT908614	hsa-miR-767-3p	CLIP-seq
MIRT908615	hsa-miR-770-5p	CLIP-seq
MIRT908616	hsa-miR-876-3p	CLIP-seq
MIRT908617	hsa-miR-889	CLIP-seq
MIRT908618	hsa-miR-890	CLIP-seq
MIRT908619	hsa-miR-92a	CLIP-seq
MIRT908620	hsa-miR-92b	CLIP-seq
MIRT908621	hsa-miR-93	CLIP-seq
MIRT908622	hsa-miR-936	CLIP-seq
MIRT908623	hsa-miR-941	CLIP-seq
MIRT908624	hsa-miR-96	CLIP-seq
MIRT908418	hsa-miR-1323	CLIP-seq
MIRT908553	hsa-miR-4712-3p	CLIP-seq
MIRT1547453	hsa-miR-4751	CLIP-seq
MIRT908566	hsa-miR-4786-5p	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT908596	hsa-miR-548o	CLIP-seq
MIRT908584	hsa-miR-520d-5p	CLIP-seq
MIRT908585	hsa-miR-524-5p	CLIP-seq
MIRT908416	hsa-miR-130a	CLIP-seq
MIRT908417	hsa-miR-130b	CLIP-seq
MIRT1922667	hsa-miR-148a	CLIP-seq
MIRT1922668	hsa-miR-148b	CLIP-seq
MIRT1922669	hsa-miR-152	CLIP-seq
MIRT1922670	hsa-miR-1825	CLIP-seq
MIRT908442	hsa-miR-301a	CLIP-seq
MIRT908443	hsa-miR-301b	CLIP-seq
MIRT908479	hsa-miR-3666	CLIP-seq
MIRT908509	hsa-miR-4295	CLIP-seq
MIRT908535	hsa-miR-454	CLIP-seq
MIRT1922671	hsa-miR-4761-5p	CLIP-seq
MIRT1922672	hsa-miR-4793-5p	CLIP-seq
MIRT908403	hsa-miR-1200	CLIP-seq
MIRT908409	hsa-miR-1264	CLIP-seq
MIRT1969242	hsa-miR-1294	CLIP-seq
MIRT1969243	hsa-miR-1297	CLIP-seq
MIRT1969244	hsa-miR-1298	CLIP-seq
MIRT908418	hsa-miR-1323	CLIP-seq
MIRT1969245	hsa-miR-1324	CLIP-seq
MIRT908419	hsa-miR-134	CLIP-seq
MIRT908421	hsa-miR-155	CLIP-seq
MIRT908423	hsa-miR-181a	CLIP-seq
MIRT908424	hsa-miR-181b	CLIP-seq
MIRT908425	hsa-miR-181c	CLIP-seq
MIRT908426	hsa-miR-181d	CLIP-seq
MIRT908433	hsa-miR-2053	CLIP-seq
MIRT1969246	hsa-miR-214	CLIP-seq
MIRT908438	hsa-miR-2682	CLIP-seq
MIRT1969247	hsa-miR-26a	CLIP-seq
MIRT1969248	hsa-miR-26b	CLIP-seq
MIRT1969249	hsa-miR-299-5p	CLIP-seq
MIRT1969250	hsa-miR-302f	CLIP-seq
MIRT908448	hsa-miR-3064-3p	CLIP-seq
MIRT1969251	hsa-miR-3065-5p	CLIP-seq
MIRT908451	hsa-miR-3118	CLIP-seq
MIRT1969252	hsa-miR-3140-3p	CLIP-seq
MIRT1969253	hsa-miR-3143	CLIP-seq
MIRT1969254	hsa-miR-3146	CLIP-seq
MIRT1969255	hsa-miR-3149	CLIP-seq
MIRT908462	hsa-miR-3160-5p	CLIP-seq
MIRT908463	hsa-miR-3163	CLIP-seq
MIRT908468	hsa-miR-330-3p	CLIP-seq
MIRT1969256	hsa-miR-338-5p	CLIP-seq
MIRT908470	hsa-miR-342-3p	CLIP-seq
MIRT1969257	hsa-miR-361-5p	CLIP-seq
MIRT1969258	hsa-miR-3619-5p	CLIP-seq
MIRT1969259	hsa-miR-365	CLIP-seq
MIRT1969260	hsa-miR-3653	CLIP-seq
MIRT1969261	hsa-miR-3658	CLIP-seq
MIRT908477	hsa-miR-3662	CLIP-seq
MIRT1969262	hsa-miR-3688-3p	CLIP-seq
MIRT1969263	hsa-miR-375	CLIP-seq
MIRT908497	hsa-miR-384	CLIP-seq
MIRT1969264	hsa-miR-3941	CLIP-seq
MIRT1969265	hsa-miR-425	CLIP-seq
MIRT908503	hsa-miR-4262	CLIP-seq
MIRT908505	hsa-miR-4269	CLIP-seq
MIRT908506	hsa-miR-4270	CLIP-seq
MIRT1969266	hsa-miR-4273	CLIP-seq
MIRT1969267	hsa-miR-4291	CLIP-seq
MIRT908513	hsa-miR-4310	CLIP-seq
MIRT1969268	hsa-miR-4316	CLIP-seq
MIRT908517	hsa-miR-4328	CLIP-seq
MIRT908519	hsa-miR-4422	CLIP-seq
MIRT908521	hsa-miR-4441	CLIP-seq
MIRT1969269	hsa-miR-4465	CLIP-seq
MIRT1969270	hsa-miR-4496	CLIP-seq
MIRT908527	hsa-miR-449c	CLIP-seq
MIRT1969271	hsa-miR-4511	CLIP-seq
MIRT908530	hsa-miR-4514	CLIP-seq
MIRT1969272	hsa-miR-4672	CLIP-seq
MIRT1969273	hsa-miR-4677-3p	CLIP-seq
MIRT1969274	hsa-miR-4677-5p	CLIP-seq
MIRT1969275	hsa-miR-4679	CLIP-seq
MIRT908547	hsa-miR-4692	CLIP-seq
MIRT1969276	hsa-miR-4698	CLIP-seq
MIRT908553	hsa-miR-4712-3p	CLIP-seq
MIRT908555	hsa-miR-4717-3p	CLIP-seq
MIRT908556	hsa-miR-4719	CLIP-seq
MIRT908559	hsa-miR-4731-3p	CLIP-seq
MIRT908560	hsa-miR-4742-5p	CLIP-seq
MIRT1547453	hsa-miR-4751	CLIP-seq
MIRT908563	hsa-miR-4777-5p	CLIP-seq
MIRT908564	hsa-miR-4778-3p	CLIP-seq
MIRT908565	hsa-miR-4778-5p	CLIP-seq
MIRT1922672	hsa-miR-4793-5p	CLIP-seq
MIRT908570	hsa-miR-4801	CLIP-seq
MIRT908571	hsa-miR-491-3p	CLIP-seq
MIRT1969277	hsa-miR-505	CLIP-seq
MIRT1969278	hsa-miR-513b	CLIP-seq
MIRT908576	hsa-miR-518d-5p	CLIP-seq
MIRT908579	hsa-miR-519b-5p	CLIP-seq
MIRT908581	hsa-miR-519c-5p	CLIP-seq
MIRT908583	hsa-miR-520c-5p	CLIP-seq
MIRT908584	hsa-miR-520d-5p	CLIP-seq
MIRT908585	hsa-miR-524-5p	CLIP-seq
MIRT908586	hsa-miR-526a	CLIP-seq
MIRT908588	hsa-miR-543	CLIP-seq
MIRT908589	hsa-miR-544b	CLIP-seq
MIRT908590	hsa-miR-548a-3p	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT1969279	hsa-miR-548ad	CLIP-seq
MIRT1969280	hsa-miR-548b-3p	CLIP-seq
MIRT908592	hsa-miR-548c-3p	CLIP-seq
MIRT908593	hsa-miR-548e	CLIP-seq
MIRT908594	hsa-miR-548f	CLIP-seq
MIRT908596	hsa-miR-548o	CLIP-seq
MIRT908599	hsa-miR-561	CLIP-seq
MIRT1969281	hsa-miR-562	CLIP-seq
MIRT908600	hsa-miR-569	CLIP-seq
MIRT908603	hsa-miR-586	CLIP-seq
MIRT1969282	hsa-miR-593	CLIP-seq
MIRT1969283	hsa-miR-617	CLIP-seq
MIRT1969284	hsa-miR-627	CLIP-seq
MIRT1969285	hsa-miR-633	CLIP-seq
MIRT908608	hsa-miR-643	CLIP-seq
MIRT1969286	hsa-miR-761	CLIP-seq
MIRT908617	hsa-miR-889	CLIP-seq
MIRT1969287	hsa-miR-922	CLIP-seq
MIRT1969288	hsa-miR-924	CLIP-seq
MIRT1969289	hsa-miR-940	CLIP-seq
MIRT908623	hsa-miR-941	CLIP-seq
MIRT908403	hsa-miR-1200	CLIP-seq
MIRT2205266	hsa-miR-3175	CLIP-seq
MIRT908520	hsa-miR-4434	CLIP-seq
MIRT908531	hsa-miR-4516	CLIP-seq
MIRT2205267	hsa-miR-512-5p	CLIP-seq
MIRT908401	hsa-miR-106a	CLIP-seq
MIRT908402	hsa-miR-106b	CLIP-seq
MIRT2205268	hsa-miR-1197	CLIP-seq
MIRT908403	hsa-miR-1200	CLIP-seq
MIRT2205269	hsa-miR-1208	CLIP-seq
MIRT2205270	hsa-miR-122	CLIP-seq
MIRT2205271	hsa-miR-1236	CLIP-seq
MIRT2205272	hsa-miR-1245b-3p	CLIP-seq
MIRT908405	hsa-miR-1252	CLIP-seq
MIRT2205273	hsa-miR-125a-5p	CLIP-seq
MIRT2205274	hsa-miR-125b	CLIP-seq
MIRT908409	hsa-miR-1264	CLIP-seq
MIRT908410	hsa-miR-1271	CLIP-seq
MIRT2205275	hsa-miR-1273f	CLIP-seq
MIRT908413	hsa-miR-128	CLIP-seq
MIRT908414	hsa-miR-1287	CLIP-seq
MIRT2205276	hsa-miR-129-5p	CLIP-seq
MIRT1969243	hsa-miR-1297	CLIP-seq
MIRT908416	hsa-miR-130a	CLIP-seq
MIRT908417	hsa-miR-130b	CLIP-seq
MIRT2205277	hsa-miR-1322	CLIP-seq
MIRT908418	hsa-miR-1323	CLIP-seq
MIRT908419	hsa-miR-134	CLIP-seq
MIRT2205278	hsa-miR-140-3p	CLIP-seq
MIRT2205279	hsa-miR-143	CLIP-seq
MIRT908421	hsa-miR-155	CLIP-seq
MIRT908422	hsa-miR-17	CLIP-seq
MIRT908423	hsa-miR-181a	CLIP-seq
MIRT908424	hsa-miR-181b	CLIP-seq
MIRT908425	hsa-miR-181c	CLIP-seq
MIRT908426	hsa-miR-181d	CLIP-seq
MIRT908427	hsa-miR-182	CLIP-seq
MIRT2205280	hsa-miR-1827	CLIP-seq
MIRT2205281	hsa-miR-190	CLIP-seq
MIRT2205282	hsa-miR-190b	CLIP-seq
MIRT2205283	hsa-miR-1913	CLIP-seq
MIRT908429	hsa-miR-199a-3p	CLIP-seq
MIRT908430	hsa-miR-199b-3p	CLIP-seq
MIRT908432	hsa-miR-205	CLIP-seq
MIRT908434	hsa-miR-20a	CLIP-seq
MIRT908435	hsa-miR-20b	CLIP-seq
MIRT2205284	hsa-miR-22	CLIP-seq
MIRT908437	hsa-miR-25	CLIP-seq
MIRT1969247	hsa-miR-26a	CLIP-seq
MIRT1969248	hsa-miR-26b	CLIP-seq
MIRT908439	hsa-miR-27a	CLIP-seq
MIRT908440	hsa-miR-27b	CLIP-seq
MIRT2205285	hsa-miR-298	CLIP-seq
MIRT1969249	hsa-miR-299-5p	CLIP-seq
MIRT908442	hsa-miR-301a	CLIP-seq
MIRT908443	hsa-miR-301b	CLIP-seq
MIRT908444	hsa-miR-302a	CLIP-seq
MIRT908445	hsa-miR-302b	CLIP-seq
MIRT908446	hsa-miR-302c	CLIP-seq
MIRT908447	hsa-miR-302d	CLIP-seq
MIRT908448	hsa-miR-3064-3p	CLIP-seq
MIRT1969251	hsa-miR-3065-5p	CLIP-seq
MIRT908451	hsa-miR-3118	CLIP-seq
MIRT2205286	hsa-miR-3126-3p	CLIP-seq
MIRT908454	hsa-miR-3129-5p	CLIP-seq
MIRT908455	hsa-miR-3135b	CLIP-seq
MIRT2205287	hsa-miR-3148	CLIP-seq
MIRT2205288	hsa-miR-3157-5p	CLIP-seq
MIRT908463	hsa-miR-3163	CLIP-seq
MIRT908464	hsa-miR-3164	CLIP-seq
MIRT2205266	hsa-miR-3175	CLIP-seq
MIRT2205289	hsa-miR-3184	CLIP-seq
MIRT2205290	hsa-miR-3187-3p	CLIP-seq
MIRT908465	hsa-miR-32	CLIP-seq
MIRT2205291	hsa-miR-324-3p	CLIP-seq
MIRT908468	hsa-miR-330-3p	CLIP-seq
MIRT1969256	hsa-miR-338-5p	CLIP-seq
MIRT2205292	hsa-miR-345	CLIP-seq
MIRT2205293	hsa-miR-346	CLIP-seq
MIRT908471	hsa-miR-34c-3p	CLIP-seq
MIRT2205294	hsa-miR-3609	CLIP-seq
MIRT2205295	hsa-miR-3612	CLIP-seq
MIRT2205296	hsa-miR-3613-3p	CLIP-seq
MIRT2205297	hsa-miR-3614-5p	CLIP-seq
MIRT908474	hsa-miR-363	CLIP-seq
MIRT908476	hsa-miR-3647-3p	CLIP-seq
MIRT1969259	hsa-miR-365	CLIP-seq
MIRT2205298	hsa-miR-3652	CLIP-seq
MIRT1969260	hsa-miR-3653	CLIP-seq
MIRT1969261	hsa-miR-3658	CLIP-seq
MIRT2205299	hsa-miR-3663-5p	CLIP-seq
MIRT908478	hsa-miR-3665	CLIP-seq
MIRT908479	hsa-miR-3666	CLIP-seq
MIRT2205300	hsa-miR-3667-3p	CLIP-seq
MIRT908480	hsa-miR-367	CLIP-seq
MIRT1969262	hsa-miR-3688-3p	CLIP-seq
MIRT2205301	hsa-miR-371-5p	CLIP-seq
MIRT2205302	hsa-miR-371b-5p	CLIP-seq
MIRT908487	hsa-miR-372	CLIP-seq
MIRT908488	hsa-miR-373	CLIP-seq
MIRT908491	hsa-miR-376a	CLIP-seq
MIRT908492	hsa-miR-376b	CLIP-seq
MIRT908493	hsa-miR-376c	CLIP-seq
MIRT908495	hsa-miR-381	CLIP-seq
MIRT908497	hsa-miR-384	CLIP-seq
MIRT2205303	hsa-miR-3907	CLIP-seq
MIRT2205304	hsa-miR-3926	CLIP-seq
MIRT2205305	hsa-miR-3927	CLIP-seq
MIRT908499	hsa-miR-3934	CLIP-seq
MIRT2205306	hsa-miR-3942-3p	CLIP-seq
MIRT908500	hsa-miR-3942-5p	CLIP-seq
MIRT2205307	hsa-miR-421	CLIP-seq
MIRT1969265	hsa-miR-425	CLIP-seq
MIRT908502	hsa-miR-4255	CLIP-seq
MIRT2205308	hsa-miR-4256	CLIP-seq
MIRT908503	hsa-miR-4262	CLIP-seq
MIRT908506	hsa-miR-4270	CLIP-seq
MIRT2205309	hsa-miR-4281	CLIP-seq
MIRT908508	hsa-miR-4282	CLIP-seq
MIRT1969267	hsa-miR-4291	CLIP-seq
MIRT908509	hsa-miR-4295	CLIP-seq
MIRT908513	hsa-miR-4310	CLIP-seq
MIRT2205310	hsa-miR-4313	CLIP-seq
MIRT2205311	hsa-miR-4319	CLIP-seq
MIRT2205312	hsa-miR-433	CLIP-seq
MIRT2205313	hsa-miR-4330	CLIP-seq
MIRT908519	hsa-miR-4422	CLIP-seq
MIRT2205314	hsa-miR-4430	CLIP-seq
MIRT908520	hsa-miR-4434	CLIP-seq
MIRT2205315	hsa-miR-4435	CLIP-seq
MIRT908521	hsa-miR-4441	CLIP-seq
MIRT2205316	hsa-miR-4443	CLIP-seq
MIRT908522	hsa-miR-4447	CLIP-seq
MIRT2205317	hsa-miR-4448	CLIP-seq
MIRT908523	hsa-miR-4457	CLIP-seq
MIRT1969269	hsa-miR-4465	CLIP-seq
MIRT908524	hsa-miR-4472	CLIP-seq
MIRT908526	hsa-miR-4495	CLIP-seq
MIRT1969270	hsa-miR-4496	CLIP-seq
MIRT2205318	hsa-miR-4503	CLIP-seq
MIRT2205319	hsa-miR-450b-5p	CLIP-seq
MIRT908531	hsa-miR-4516	CLIP-seq
MIRT908532	hsa-miR-4525	CLIP-seq
MIRT2205320	hsa-miR-4527	CLIP-seq
MIRT2205321	hsa-miR-4534	CLIP-seq
MIRT908534	hsa-miR-4539	CLIP-seq
MIRT908535	hsa-miR-454	CLIP-seq
MIRT908538	hsa-miR-4645-3p	CLIP-seq
MIRT2205322	hsa-miR-4650-3p	CLIP-seq
MIRT908544	hsa-miR-4665-5p	CLIP-seq
MIRT908545	hsa-miR-4666-3p	CLIP-seq
MIRT2205323	hsa-miR-4666-5p	CLIP-seq
MIRT908546	hsa-miR-4668-3p	CLIP-seq
MIRT2205324	hsa-miR-4691-3p	CLIP-seq
MIRT2205325	hsa-miR-4701-5p	CLIP-seq
MIRT908550	hsa-miR-4703-5p	CLIP-seq
MIRT2205326	hsa-miR-4704-3p	CLIP-seq
MIRT908551	hsa-miR-4705	CLIP-seq
MIRT2205327	hsa-miR-4708-5p	CLIP-seq
MIRT908552	hsa-miR-4709-5p	CLIP-seq
MIRT908553	hsa-miR-4712-3p	CLIP-seq
MIRT908556	hsa-miR-4719	CLIP-seq
MIRT908557	hsa-miR-4723-5p	CLIP-seq
MIRT2205328	hsa-miR-4736	CLIP-seq
MIRT1547453	hsa-miR-4751	CLIP-seq
MIRT2205329	hsa-miR-4770	CLIP-seq
MIRT908563	hsa-miR-4777-5p	CLIP-seq
MIRT908564	hsa-miR-4778-3p	CLIP-seq
MIRT908565	hsa-miR-4778-5p	CLIP-seq
MIRT908566	hsa-miR-4786-5p	CLIP-seq
MIRT2205330	hsa-miR-4795-5p	CLIP-seq
MIRT2205331	hsa-miR-4802-3p	CLIP-seq
MIRT2205332	hsa-miR-4803	CLIP-seq
MIRT2205333	hsa-miR-485-3p	CLIP-seq
MIRT908571	hsa-miR-491-3p	CLIP-seq
MIRT2205334	hsa-miR-495	CLIP-seq
MIRT2205335	hsa-miR-499-3p	CLIP-seq
MIRT2205336	hsa-miR-499a-3p	CLIP-seq
MIRT2205267	hsa-miR-512-5p	CLIP-seq
MIRT908575	hsa-miR-513a-5p	CLIP-seq
MIRT1969278	hsa-miR-513b	CLIP-seq
MIRT2205337	hsa-miR-518a-5p	CLIP-seq
MIRT908576	hsa-miR-518d-5p	CLIP-seq
MIRT908579	hsa-miR-519b-5p	CLIP-seq
MIRT908581	hsa-miR-519c-5p	CLIP-seq
MIRT908582	hsa-miR-519d	CLIP-seq
MIRT908583	hsa-miR-520c-5p	CLIP-seq
MIRT908584	hsa-miR-520d-5p	CLIP-seq
MIRT2205338	hsa-miR-520g	CLIP-seq
MIRT908585	hsa-miR-524-5p	CLIP-seq
MIRT908586	hsa-miR-526a	CLIP-seq
MIRT2205339	hsa-miR-526b	CLIP-seq
MIRT2205340	hsa-miR-527	CLIP-seq
MIRT908587	hsa-miR-539	CLIP-seq
MIRT908588	hsa-miR-543	CLIP-seq
MIRT908589	hsa-miR-544b	CLIP-seq
MIRT908590	hsa-miR-548a-3p	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT2205341	hsa-miR-548ah	CLIP-seq
MIRT908593	hsa-miR-548e	CLIP-seq
MIRT908594	hsa-miR-548f	CLIP-seq
MIRT2205342	hsa-miR-548m	CLIP-seq
MIRT908596	hsa-miR-548o	CLIP-seq
MIRT2205343	hsa-miR-548s	CLIP-seq
MIRT2205344	hsa-miR-549	CLIP-seq
MIRT908599	hsa-miR-561	CLIP-seq
MIRT908601	hsa-miR-577	CLIP-seq
MIRT2205345	hsa-miR-579	CLIP-seq
MIRT2205346	hsa-miR-580	CLIP-seq
MIRT2205347	hsa-miR-587	CLIP-seq
MIRT2205348	hsa-miR-588	CLIP-seq
MIRT1969283	hsa-miR-617	CLIP-seq
MIRT908605	hsa-miR-625	CLIP-seq
MIRT2205349	hsa-miR-642a	CLIP-seq
MIRT2205350	hsa-miR-642b	CLIP-seq
MIRT908609	hsa-miR-646	CLIP-seq
MIRT2205351	hsa-miR-650	CLIP-seq
MIRT2205352	hsa-miR-654-3p	CLIP-seq
MIRT908610	hsa-miR-676	CLIP-seq
MIRT908617	hsa-miR-889	CLIP-seq
MIRT908619	hsa-miR-92a	CLIP-seq
MIRT908620	hsa-miR-92b	CLIP-seq
MIRT908621	hsa-miR-93	CLIP-seq
MIRT908622	hsa-miR-936	CLIP-seq
MIRT1969289	hsa-miR-940	CLIP-seq
MIRT908624	hsa-miR-96	CLIP-seq
MIRT1969245	hsa-miR-1324	CLIP-seq
MIRT2386439	hsa-miR-1307	CLIP-seq
MIRT908418	hsa-miR-1323	CLIP-seq
MIRT1922670	hsa-miR-1825	CLIP-seq
MIRT2205266	hsa-miR-3175	CLIP-seq
MIRT2205303	hsa-miR-3907	CLIP-seq
MIRT908520	hsa-miR-4434	CLIP-seq
MIRT908531	hsa-miR-4516	CLIP-seq
MIRT2386440	hsa-miR-4638-5p	CLIP-seq
MIRT2386441	hsa-miR-4714-3p	CLIP-seq
MIRT908556	hsa-miR-4719	CLIP-seq
MIRT2205330	hsa-miR-4795-5p	CLIP-seq
MIRT2386442	hsa-miR-501-3p	CLIP-seq
MIRT2386443	hsa-miR-502-3p	CLIP-seq
MIRT908589	hsa-miR-544b	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT908596	hsa-miR-548o	CLIP-seq
MIRT1969283	hsa-miR-617	CLIP-seq
MIRT2205270	hsa-miR-122	CLIP-seq
MIRT2205275	hsa-miR-1273f	CLIP-seq
MIRT2447580	hsa-miR-224	CLIP-seq
MIRT1969255	hsa-miR-3149	CLIP-seq
MIRT2447581	hsa-miR-3150b-3p	CLIP-seq
MIRT2447582	hsa-miR-3170	CLIP-seq
MIRT2447583	hsa-miR-3194-5p	CLIP-seq
MIRT2447584	hsa-miR-3198	CLIP-seq
MIRT2447585	hsa-miR-411	CLIP-seq
MIRT2447586	hsa-miR-4309	CLIP-seq
MIRT2205324	hsa-miR-4691-3p	CLIP-seq
MIRT2447587	hsa-miR-4709-3p	CLIP-seq
MIRT908555	hsa-miR-4717-3p	CLIP-seq
MIRT2447588	hsa-miR-4765	CLIP-seq
MIRT2447589	hsa-miR-4775	CLIP-seq
MIRT2447590	hsa-miR-4784	CLIP-seq
MIRT2447591	hsa-miR-4794	CLIP-seq
MIRT2447592	hsa-miR-590-3p	CLIP-seq
MIRT2205278	hsa-miR-140-3p	CLIP-seq
MIRT1969256	hsa-miR-338-5p	CLIP-seq
MIRT2205315	hsa-miR-4435	CLIP-seq
MIRT908401	hsa-miR-106a	CLIP-seq
MIRT908402	hsa-miR-106b	CLIP-seq
MIRT908403	hsa-miR-1200	CLIP-seq
MIRT908408	hsa-miR-125a-3p	CLIP-seq
MIRT2508613	hsa-miR-1261	CLIP-seq
MIRT2205275	hsa-miR-1273f	CLIP-seq
MIRT2508614	hsa-miR-1276	CLIP-seq
MIRT908416	hsa-miR-130a	CLIP-seq
MIRT908417	hsa-miR-130b	CLIP-seq
MIRT908418	hsa-miR-1323	CLIP-seq
MIRT2508615	hsa-miR-1343	CLIP-seq
MIRT2205278	hsa-miR-140-3p	CLIP-seq
MIRT2508616	hsa-miR-141	CLIP-seq
MIRT2508617	hsa-miR-142-5p	CLIP-seq
MIRT2508618	hsa-miR-150	CLIP-seq
MIRT908421	hsa-miR-155	CLIP-seq
MIRT908422	hsa-miR-17	CLIP-seq
MIRT2205281	hsa-miR-190	CLIP-seq
MIRT2205282	hsa-miR-190b	CLIP-seq
MIRT2508619	hsa-miR-192	CLIP-seq
MIRT2508620	hsa-miR-197	CLIP-seq
MIRT2508621	hsa-miR-200a	CLIP-seq
MIRT2508622	hsa-miR-204	CLIP-seq
MIRT908434	hsa-miR-20a	CLIP-seq
MIRT908435	hsa-miR-20b	CLIP-seq
MIRT2508623	hsa-miR-211	CLIP-seq
MIRT2508624	hsa-miR-215	CLIP-seq
MIRT908437	hsa-miR-25	CLIP-seq
MIRT1969249	hsa-miR-299-5p	CLIP-seq
MIRT908442	hsa-miR-301a	CLIP-seq
MIRT908443	hsa-miR-301b	CLIP-seq
MIRT908444	hsa-miR-302a	CLIP-seq
MIRT908445	hsa-miR-302b	CLIP-seq
MIRT908446	hsa-miR-302c	CLIP-seq
MIRT908447	hsa-miR-302d	CLIP-seq
MIRT1969251	hsa-miR-3065-5p	CLIP-seq
MIRT2508625	hsa-miR-3120-3p	CLIP-seq
MIRT908457	hsa-miR-3138	CLIP-seq
MIRT1969253	hsa-miR-3143	CLIP-seq
MIRT2205287	hsa-miR-3148	CLIP-seq
MIRT1969255	hsa-miR-3149	CLIP-seq
MIRT2205288	hsa-miR-3157-5p	CLIP-seq
MIRT908462	hsa-miR-3160-5p	CLIP-seq
MIRT2447582	hsa-miR-3170	CLIP-seq
MIRT2205290	hsa-miR-3187-3p	CLIP-seq
MIRT2447583	hsa-miR-3194-5p	CLIP-seq
MIRT908465	hsa-miR-32	CLIP-seq
MIRT908467	hsa-miR-323-5p	CLIP-seq
MIRT1969256	hsa-miR-338-5p	CLIP-seq
MIRT2508626	hsa-miR-340	CLIP-seq
MIRT2205297	hsa-miR-3614-5p	CLIP-seq
MIRT2508627	hsa-miR-362-5p	CLIP-seq
MIRT908474	hsa-miR-363	CLIP-seq
MIRT1969259	hsa-miR-365	CLIP-seq
MIRT908479	hsa-miR-3666	CLIP-seq
MIRT908480	hsa-miR-367	CLIP-seq
MIRT2508628	hsa-miR-3671	CLIP-seq
MIRT1969262	hsa-miR-3688-3p	CLIP-seq
MIRT908487	hsa-miR-372	CLIP-seq
MIRT908488	hsa-miR-373	CLIP-seq
MIRT908494	hsa-miR-380	CLIP-seq
MIRT908496	hsa-miR-383	CLIP-seq
MIRT2508629	hsa-miR-3913-3p	CLIP-seq
MIRT2205304	hsa-miR-3926	CLIP-seq
MIRT2508630	hsa-miR-3938	CLIP-seq
MIRT908501	hsa-miR-410	CLIP-seq
MIRT2447585	hsa-miR-411	CLIP-seq
MIRT2508631	hsa-miR-4274	CLIP-seq
MIRT908509	hsa-miR-4295	CLIP-seq
MIRT908513	hsa-miR-4310	CLIP-seq
MIRT2508632	hsa-miR-4311	CLIP-seq
MIRT908516	hsa-miR-4324	CLIP-seq
MIRT2205312	hsa-miR-433	CLIP-seq
MIRT908519	hsa-miR-4422	CLIP-seq
MIRT2205315	hsa-miR-4435	CLIP-seq
MIRT908525	hsa-miR-4491	CLIP-seq
MIRT2508633	hsa-miR-4493	CLIP-seq
MIRT908526	hsa-miR-4495	CLIP-seq
MIRT908535	hsa-miR-454	CLIP-seq
MIRT2508634	hsa-miR-4635	CLIP-seq
MIRT908542	hsa-miR-4657	CLIP-seq
MIRT2205323	hsa-miR-4666-5p	CLIP-seq
MIRT908546	hsa-miR-4668-3p	CLIP-seq
MIRT2508635	hsa-miR-4690-3p	CLIP-seq
MIRT2205324	hsa-miR-4691-3p	CLIP-seq
MIRT2205325	hsa-miR-4701-5p	CLIP-seq
MIRT2205326	hsa-miR-4704-3p	CLIP-seq
MIRT908552	hsa-miR-4709-5p	CLIP-seq
MIRT2508636	hsa-miR-4710	CLIP-seq
MIRT2386441	hsa-miR-4714-3p	CLIP-seq
MIRT2508637	hsa-miR-4729	CLIP-seq
MIRT2508638	hsa-miR-4749-3p	CLIP-seq
MIRT1547453	hsa-miR-4751	CLIP-seq
MIRT2508639	hsa-miR-4755-5p	CLIP-seq
MIRT2508640	hsa-miR-4757-5p	CLIP-seq
MIRT2508641	hsa-miR-4766-5p	CLIP-seq
MIRT908562	hsa-miR-4772-5p	CLIP-seq
MIRT2447589	hsa-miR-4775	CLIP-seq
MIRT2447591	hsa-miR-4794	CLIP-seq
MIRT908569	hsa-miR-4800-5p	CLIP-seq
MIRT2205331	hsa-miR-4802-3p	CLIP-seq
MIRT2205332	hsa-miR-4803	CLIP-seq
MIRT2508642	hsa-miR-489	CLIP-seq
MIRT908573	hsa-miR-493	CLIP-seq
MIRT2205334	hsa-miR-495	CLIP-seq
MIRT2508643	hsa-miR-498	CLIP-seq
MIRT2508644	hsa-miR-500b	CLIP-seq
MIRT908574	hsa-miR-501-5p	CLIP-seq
MIRT2508645	hsa-miR-509-3p	CLIP-seq
MIRT2508646	hsa-miR-5096	CLIP-seq
MIRT2205267	hsa-miR-512-5p	CLIP-seq
MIRT908577	hsa-miR-519a	CLIP-seq
MIRT908578	hsa-miR-519b-3p	CLIP-seq
MIRT908580	hsa-miR-519c-3p	CLIP-seq
MIRT908582	hsa-miR-519d	CLIP-seq
MIRT2205338	hsa-miR-520g	CLIP-seq
MIRT908588	hsa-miR-543	CLIP-seq
MIRT908589	hsa-miR-544b	CLIP-seq
MIRT908590	hsa-miR-548a-3p	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT2508647	hsa-miR-548ac	CLIP-seq
MIRT2508648	hsa-miR-548ae	CLIP-seq
MIRT2508649	hsa-miR-548aj	CLIP-seq
MIRT2508650	hsa-miR-548am	CLIP-seq
MIRT908592	hsa-miR-548c-3p	CLIP-seq
MIRT2508651	hsa-miR-548d-3p	CLIP-seq
MIRT908593	hsa-miR-548e	CLIP-seq
MIRT908594	hsa-miR-548f	CLIP-seq
MIRT908596	hsa-miR-548o	CLIP-seq
MIRT2205343	hsa-miR-548s	CLIP-seq
MIRT2508652	hsa-miR-548x	CLIP-seq
MIRT2508653	hsa-miR-548z	CLIP-seq
MIRT2205344	hsa-miR-549	CLIP-seq
MIRT908598	hsa-miR-552	CLIP-seq
MIRT2205345	hsa-miR-579	CLIP-seq
MIRT2508654	hsa-miR-583	CLIP-seq
MIRT2205348	hsa-miR-588	CLIP-seq
MIRT2447592	hsa-miR-590-3p	CLIP-seq
MIRT908604	hsa-miR-607	CLIP-seq
MIRT2508655	hsa-miR-623	CLIP-seq
MIRT2508656	hsa-miR-628-5p	CLIP-seq
MIRT908606	hsa-miR-640	CLIP-seq
MIRT2205352	hsa-miR-654-3p	CLIP-seq
MIRT908616	hsa-miR-876-3p	CLIP-seq
MIRT908618	hsa-miR-890	CLIP-seq
MIRT908619	hsa-miR-92a	CLIP-seq
MIRT908620	hsa-miR-92b	CLIP-seq
MIRT908621	hsa-miR-93	CLIP-seq
MIRT908401	hsa-miR-106a	CLIP-seq
MIRT908402	hsa-miR-106b	CLIP-seq
MIRT908403	hsa-miR-1200	CLIP-seq
MIRT908408	hsa-miR-125a-3p	CLIP-seq
MIRT2205273	hsa-miR-125a-5p	CLIP-seq
MIRT2205274	hsa-miR-125b	CLIP-seq
MIRT908409	hsa-miR-1264	CLIP-seq
MIRT908410	hsa-miR-1271	CLIP-seq
MIRT2205275	hsa-miR-1273f	CLIP-seq
MIRT908416	hsa-miR-130a	CLIP-seq
MIRT908417	hsa-miR-130b	CLIP-seq
MIRT2508615	hsa-miR-1343	CLIP-seq
MIRT2205278	hsa-miR-140-3p	CLIP-seq
MIRT2508616	hsa-miR-141	CLIP-seq
MIRT2508618	hsa-miR-150	CLIP-seq
MIRT908421	hsa-miR-155	CLIP-seq
MIRT908422	hsa-miR-17	CLIP-seq
MIRT908427	hsa-miR-182	CLIP-seq
MIRT2205281	hsa-miR-190	CLIP-seq
MIRT2205282	hsa-miR-190b	CLIP-seq
MIRT2508620	hsa-miR-197	CLIP-seq
MIRT2508621	hsa-miR-200a	CLIP-seq
MIRT908433	hsa-miR-2053	CLIP-seq
MIRT908434	hsa-miR-20a	CLIP-seq
MIRT908435	hsa-miR-20b	CLIP-seq
MIRT908437	hsa-miR-25	CLIP-seq
MIRT908442	hsa-miR-301a	CLIP-seq
MIRT908443	hsa-miR-301b	CLIP-seq
MIRT908444	hsa-miR-302a	CLIP-seq
MIRT908445	hsa-miR-302b	CLIP-seq
MIRT908446	hsa-miR-302c	CLIP-seq
MIRT908447	hsa-miR-302d	CLIP-seq
MIRT908448	hsa-miR-3064-3p	CLIP-seq
MIRT2508625	hsa-miR-3120-3p	CLIP-seq
MIRT908457	hsa-miR-3138	CLIP-seq
MIRT1969253	hsa-miR-3143	CLIP-seq
MIRT2205287	hsa-miR-3148	CLIP-seq
MIRT1969255	hsa-miR-3149	CLIP-seq
MIRT908460	hsa-miR-3151	CLIP-seq
MIRT2205288	hsa-miR-3157-5p	CLIP-seq
MIRT908462	hsa-miR-3160-5p	CLIP-seq
MIRT2447582	hsa-miR-3170	CLIP-seq
MIRT2447583	hsa-miR-3194-5p	CLIP-seq
MIRT908465	hsa-miR-32	CLIP-seq
MIRT908467	hsa-miR-323-5p	CLIP-seq
MIRT1969256	hsa-miR-338-5p	CLIP-seq
MIRT2205296	hsa-miR-3613-3p	CLIP-seq
MIRT2508627	hsa-miR-362-5p	CLIP-seq
MIRT908474	hsa-miR-363	CLIP-seq
MIRT1969259	hsa-miR-365	CLIP-seq
MIRT908479	hsa-miR-3666	CLIP-seq
MIRT908480	hsa-miR-367	CLIP-seq
MIRT2508628	hsa-miR-3671	CLIP-seq
MIRT1969262	hsa-miR-3688-3p	CLIP-seq
MIRT2205302	hsa-miR-371b-5p	CLIP-seq
MIRT908487	hsa-miR-372	CLIP-seq
MIRT908488	hsa-miR-373	CLIP-seq
MIRT908494	hsa-miR-380	CLIP-seq
MIRT2508629	hsa-miR-3913-3p	CLIP-seq
MIRT2678582	hsa-miR-3914	CLIP-seq
MIRT2678583	hsa-miR-3920	CLIP-seq
MIRT2678584	hsa-miR-3977	CLIP-seq
MIRT2447585	hsa-miR-411	CLIP-seq
MIRT908504	hsa-miR-4265	CLIP-seq
MIRT908507	hsa-miR-4271	CLIP-seq
MIRT2508631	hsa-miR-4274	CLIP-seq
MIRT908509	hsa-miR-4295	CLIP-seq
MIRT908510	hsa-miR-4296	CLIP-seq
MIRT2205311	hsa-miR-4319	CLIP-seq
MIRT908515	hsa-miR-4322	CLIP-seq
MIRT908516	hsa-miR-4324	CLIP-seq
MIRT2205312	hsa-miR-433	CLIP-seq
MIRT908522	hsa-miR-4447	CLIP-seq
MIRT908524	hsa-miR-4472	CLIP-seq
MIRT908525	hsa-miR-4491	CLIP-seq
MIRT2508633	hsa-miR-4493	CLIP-seq
MIRT908526	hsa-miR-4495	CLIP-seq
MIRT2678585	hsa-miR-4517	CLIP-seq
MIRT908532	hsa-miR-4525	CLIP-seq
MIRT908535	hsa-miR-454	CLIP-seq
MIRT2508634	hsa-miR-4635	CLIP-seq
MIRT908538	hsa-miR-4645-3p	CLIP-seq
MIRT908542	hsa-miR-4657	CLIP-seq
MIRT908544	hsa-miR-4665-5p	CLIP-seq
MIRT2205323	hsa-miR-4666-5p	CLIP-seq
MIRT908546	hsa-miR-4668-3p	CLIP-seq
MIRT2508635	hsa-miR-4690-3p	CLIP-seq
MIRT2205324	hsa-miR-4691-3p	CLIP-seq
MIRT2205326	hsa-miR-4704-3p	CLIP-seq
MIRT908552	hsa-miR-4709-5p	CLIP-seq
MIRT2508636	hsa-miR-4710	CLIP-seq
MIRT2386441	hsa-miR-4714-3p	CLIP-seq
MIRT2678586	hsa-miR-4715-3p	CLIP-seq
MIRT908557	hsa-miR-4723-5p	CLIP-seq
MIRT908558	hsa-miR-4725-3p	CLIP-seq
MIRT2508637	hsa-miR-4729	CLIP-seq
MIRT2678587	hsa-miR-4732-3p	CLIP-seq
MIRT2508638	hsa-miR-4749-3p	CLIP-seq
MIRT1547453	hsa-miR-4751	CLIP-seq
MIRT2508640	hsa-miR-4757-5p	CLIP-seq
MIRT2447589	hsa-miR-4775	CLIP-seq
MIRT2678588	hsa-miR-4776-3p	CLIP-seq
MIRT908564	hsa-miR-4778-3p	CLIP-seq
MIRT2447591	hsa-miR-4794	CLIP-seq
MIRT908569	hsa-miR-4800-5p	CLIP-seq
MIRT2205331	hsa-miR-4802-3p	CLIP-seq
MIRT2508642	hsa-miR-489	CLIP-seq
MIRT908572	hsa-miR-491-5p	CLIP-seq
MIRT908573	hsa-miR-493	CLIP-seq
MIRT2508643	hsa-miR-498	CLIP-seq
MIRT2508644	hsa-miR-500b	CLIP-seq
MIRT908574	hsa-miR-501-5p	CLIP-seq
MIRT2508646	hsa-miR-5096	CLIP-seq
MIRT2205267	hsa-miR-512-5p	CLIP-seq
MIRT908577	hsa-miR-519a	CLIP-seq
MIRT908578	hsa-miR-519b-3p	CLIP-seq
MIRT908580	hsa-miR-519c-3p	CLIP-seq
MIRT908582	hsa-miR-519d	CLIP-seq
MIRT2205338	hsa-miR-520g	CLIP-seq
MIRT908588	hsa-miR-543	CLIP-seq
MIRT908589	hsa-miR-544b	CLIP-seq
MIRT908590	hsa-miR-548a-3p	CLIP-seq
MIRT908591	hsa-miR-548aa	CLIP-seq
MIRT2508647	hsa-miR-548ac	CLIP-seq
MIRT2508651	hsa-miR-548d-3p	CLIP-seq
MIRT908593	hsa-miR-548e	CLIP-seq
MIRT908594	hsa-miR-548f	CLIP-seq
MIRT2508653	hsa-miR-548z	CLIP-seq
MIRT2205344	hsa-miR-549	CLIP-seq
MIRT908598	hsa-miR-552	CLIP-seq
MIRT908600	hsa-miR-569	CLIP-seq
MIRT2205345	hsa-miR-579	CLIP-seq
MIRT2447592	hsa-miR-590-3p	CLIP-seq
MIRT908604	hsa-miR-607	CLIP-seq
MIRT908605	hsa-miR-625	CLIP-seq
MIRT908606	hsa-miR-640	CLIP-seq
MIRT2205352	hsa-miR-654-3p	CLIP-seq
MIRT2678589	hsa-miR-670	CLIP-seq
MIRT908616	hsa-miR-876-3p	CLIP-seq
MIRT908617	hsa-miR-889	CLIP-seq
MIRT908619	hsa-miR-92a	CLIP-seq
MIRT908620	hsa-miR-92b	CLIP-seq
MIRT908621	hsa-miR-93	CLIP-seq
MIRT908624	hsa-miR-96	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF5	Activation	17140605
CREBBP	Activation	19564345
CREM	Repression	11988318
FOXO4	Activation	20136501
SP1	Unknown	17937658
SRF	Repression	1531519

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	19861239
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	9065434, 19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10722738, 14506290, 15964553, 16325578, 16799563, 17476304, 18160048, 18316612, 20102225, 20159610, 20541704, 20936779, 21172805, 21418524, 21988832, 25609649, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	8798441
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1655749, 12871976, 20102225
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISO
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006468	Process	Protein phosphorylation	IDA	8798441
GO:0007165	Process	Signal transduction	TAS	2974179
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007595	Process	Lactation	IEA
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0008361	Process	Regulation of cell size	IEA
GO:0008542	Process	Visual learning	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IDA	19861239
GO:0014074	Process	Response to purine-containing compound	IDA	25644539
GO:0014823	Process	Response to activity	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0021983	Process	Pituitary gland development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032916	Process	Positive regulation of transforming growth factor beta3 production	IEA
GO:0033363	Process	Secretory granule organization	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0033762	Process	Response to glucagon	ISS
GO:0034670	Process	Chemotaxis to arachidonate	IEA
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035094	Process	Response to nicotine	IEA
GO:0035497	Function	CAMP response element binding	IBA
GO:0035497	Function	CAMP response element binding	IDA	19861239
GO:0035497	Function	CAMP response element binding	IEA
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0036017	Process	Response to erythropoietin	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	25644539
GO:0042802	Function	Identical protein binding	IPI	20102225, 23661758, 25609649
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043278	Process	Response to morphine	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8798441
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1655749, 19861239
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046879	Process	Hormone secretion	IEA
GO:0046887	Process	Positive regulation of hormone secretion	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IEA
GO:0046889	Process	Positive regulation of lipid biosynthetic process	ISS
GO:0048145	Process	Regulation of fibroblast proliferation	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0055025	Process	Positive regulation of cardiac muscle tissue development	IEA
GO:0060251	Process	Regulation of glial cell proliferation	IEA
GO:0060428	Process	Lung epithelium development	IEA
GO:0060430	Process	Lung saccule development	IEA
GO:0060509	Process	Type I pneumocyte differentiation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19861239
GO:0071294	Process	Cellular response to zinc ion	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISO
GO:0141156	Process	CAMP/PKA signal transduction	IBA
GO:0141156	Process	CAMP/PKA signal transduction	IDA	25644539
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:1902065	Process	Response to L-glutamate	IEA
GO:1903494	Process	Response to dehydroepiandrosterone	IEA
GO:1904181	Process	Positive regulation of membrane depolarization	IEA
GO:1904322	Process	Cellular response to forskolin	IDA	25644539
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IBA
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IDA	12871976
GO:1990589	Component	ATF4-CREB1 transcription factor complex	IEA
GO:1990763	Function	Arrestin family protein binding	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990910	Process	Response to hypobaric hypoxia	IEA
GO:2000224	Process	Regulation of testosterone biosynthetic process	IEA

Other IDs

• MIM: 123810
• HGNC: 2345
• e!Ensembl: ENSG00000118260

Protein

• UniProt ID: P16220
• Protein name: Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)
• Protein function: Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters (By similarity). Transcription activation is enhanced by th
• PDB: 2LXT, 5ZK1, 5ZKO, 7TBH
• Family and domains:

  Pfam

  
  Warning: Undefined array key 339 in /var/www/html/gene_detail.php on line 1100
  

  Accession	ID	Position in sequence	Description	Type
  PF02173	pKID	113 → 153	pKID domain	Family
  PF00170	bZIP_1	281 → 340	bZIP transcription factor	Coiled-coil

• Sequence:

  MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
  GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
  RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
  NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
  RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
  VAVLENQNKTLIEELKALKDLYCHKSD

• Sequence length: 327

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANGIOMATOID FIBROUS HISTIOCYTOMA	—	ClinVar, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA OF SOFT TISSUE	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA, CUTANEOUS MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	28424060, 30484112		★☆☆☆☆ Found in Text Mining only
Acrodysostosis	Acrodysostosis	BEFREE	25064455		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	26008971		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23449452		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	20541704		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22539488		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30955253		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	22510762, 28009602		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10728913		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	29846607		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	25476123		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16840326, 17950728, 19617351, 8610463		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17908236, 20037212, 23168992, 23341039, 24436131, 27480489, 30080220, 32755048, 34556089, 36153426, 36982708, 39210294	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27480489, 37762325	Inhibit	★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	16537429, 29370115, 30215650		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	26646002		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33692125	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	16822311	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	12967770, 15714041		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	19194961, 20047710	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	12967770, 15714041		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	25059547	Associate	★☆☆☆☆ Found in Text Mining only
AROMATASE EXCESS SYNDROME	Aromatase Excess Syndrome	BEFREE	18083712		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12525696		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15077295, 24816316, 9797555	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	LHGDN	15077295		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17573727		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	18204156, 30257479, 34004182	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24204796, 28063403, 28383034		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25476123		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	15073328	Inhibit	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	23588365	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12525696		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25523945, 34853624, 35003319	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35422816	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28477407		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29854847		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25648114, 29576796, 31257496		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27511066	Associate	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	16718354		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	30510446		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	30510446		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	26379158		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18189280, 23568192, 26899345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	18189280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18189280, 22386572, 23568192		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18189280, 23568192, 24148789	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24143878	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26844702, 30127997, 31072448		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23439434, 33420361	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	LHGDN	17565598		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12391146, 17786359, 19522736, 22198466, 23610368, 25472539, 27809310, 28031536, 28443471, 28571770, 30121621, 30366079, 30628071, 31676788, 31754343		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10542244, 17965603, 19442316, 21665913, 22697792, 23469012, 26474850, 26823765, 27557669, 28443471, 28467448, 28990063, 31171715, 33275230, 33910530, 34643237, 35246504	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	34564739	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18676828, 19138976, 19351775, 27458098, 31766385, 35421923	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	32156290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	9446552	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20423907, 21247894, 23391762, 26378022, 30881868, 31138777, 34028973, 34445994, 35251300, 35724265, 35769513, 35816613, 37243268, 37875967	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	32156290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	27592799	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	26503699, 39332274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26844702, 30127997, 31072448		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29563811		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12584565, 20010869, 28592245, 31083279		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25382680, 28009602, 30047065, 32300145, 32993793, 35165059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20564339	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27819677, 30105876		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	37098980	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32196466	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	28281318, 34314078	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28069924, 30550883		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	25476123		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	29924341	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	25302486		★☆☆☆☆ Found in Text Mining only
Chronic intestinal pseudo-obstruction	Intestinal Pseudoobstruction	BEFREE	28043906		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28797891		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	16766266, 17000668, 19561568, 23953591, 28009602, 30219084		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	ORPHANET_DG	19561568		★☆☆☆☆ Found in Text Mining only
Coffin-Lowry syndrome	Coffin-Lowry Syndrome	BEFREE	23844928		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	17908236, 30806012	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21476939, 23844928, 28065587		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23154639	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30816471		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21924350, 26263387, 27046651, 27145368, 27801665, 28391045, 29041002, 29100333, 31515467		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15078890, 26263387, 29041002, 29197151, 29328363, 32533792, 35773744, 38376276	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	26379158		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26796749, 28544385		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	27808477	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36032780	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24223725, 24289115		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24289115	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	20805990		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CTD_human_DG	29179997		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19293384	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	18299998		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28843170, 31182934		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	39210294	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30018265		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30134805		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	12457397, 12851637, 15999345, 17548750, 18221628, 19517574, 19548263, 20943350, 21215389, 21598377, 22152193, 23619509, 29197324, 29722134, 31255680		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19194961, 25059547	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	20643483, 21937024, 22152193, 23269207, 23619509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	22293360, 23568192, 25755794	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17554073		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17554073		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20814220	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31869513, 32041280	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22509362, 29729382, 30201537, 31387746		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23902294, 36329882	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23902294		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	18485898		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	18485898	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	17786359		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	17786359		★☆☆☆☆ Found in Text Mining only
Dyschromatosis universalis hereditaria	Dyschromatosis Universalis Hereditaria	BEFREE	28382689		★☆☆☆☆ Found in Text Mining only
Dyschromatosis universalis hereditaria	Dyschromatosis symmetrica hereditaria	Pubtator	28382689	Associate	★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	31146783	Associate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	32111982	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34855209	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18583320, 25207642, 35285386	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25207642, 29286077, 30547177		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29286077	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	25941323		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20188170, 23055509, 28078614		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23055509, 25516101	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26617801		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23929392, 26617801, 35073841	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26617801		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36848349	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	16908988, 21784978		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27279449		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	18483184		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	18483184	Associate	★☆☆☆☆ Found in Text Mining only
Gilbert Disease	Gilbert syndrome	Pubtator	37097347	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31115504		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	34646884	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	37940950	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15153340, 25084773, 29852183, 30190576, 30970642, 31807022		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15153340		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15153340, 27572852	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32183903	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15153340, 25084773, 29852183, 30190576, 30970642, 31807022		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23019365, 23185366, 27926502, 28362995, 33125147, 33557829	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23543137, 25476123, 27926502, 28646353, 29742423, 30553445		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32791747	Associate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	32970137	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	32300145	Associate	★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	16196383	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	35245485	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	21957142, 31138777	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	22038502, 28281318, 32770123, 33141488, 34193943, 34228212, 34314078, 34821426, 36593607, 37097347	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	17724745, 18094413, 22038502, 25804255, 25927151, 28009602, 28281318, 29932283, 30819530, 31305268, 31652145		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	LHGDN	17724745		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11091852		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27458098	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22186421, 22589249, 23565152, 23844928, 26604145, 27486903, 29742127		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22509362, 28167604		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	22819546	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	32938406	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	18491255	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	23902294, 37098980	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10383461, 28254846	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31834445	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32111982, 33420361	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30802716		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	27979859		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16786226, 21476939, 23844928, 25066354, 28065587, 28456375, 30134805, 30641141, 30687079, 31660837, 31737188, 31809762		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31418947	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32830408	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31499193		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	29079362		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	23100280		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	12680174, 26109721		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	9196072		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31055001		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31259702	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	38376276	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	30642265	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11895805, 18024382, 18801183, 19442316, 26008971	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	16196046, 23100280		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17661722, 17805329, 17975014		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	18801183	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11238126, 18024382, 23474756, 26840025, 31411110	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18801183, 19351775	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15837624, 16196046, 23100280, 25541153, 25915125, 27116251		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17950728, 19617351		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10842185, 23979134, 28574502, 29800612, 30321589, 31138777		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23979134		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	16079300	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24349008		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12584565, 25134518		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18281471, 20010869, 25897662, 26035432, 26056041, 28592245, 28901509, 36516759	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11238674, 21346232, 31804013	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11238674, 17211988, 21346232		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25825983	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29563811		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33275230	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22966169, 26004186, 8798441		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	22966169, 26004186, 39735560	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	29929540		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34646884	Associate	★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	20471034		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11099740, 12457397, 12851637, 17258370, 17300755, 17548750, 18213625, 18317463, 18678793, 19194961, 19517574, 20643483, 20957653, 21598377, 22152193, 22180334, 22293360, 22386572, 22480177, 23537502, 23568192, 23844928, 24006268, 24093582, 24955721, 25755794, 27219347, 28225778, 29725086		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	LHGDN	17300755		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	23844928, 24006268, 24093582, 25059218, 25755794		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	23543137, 25648114		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	19815709		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12391146, 17786359, 19522736, 22198466, 23610368, 25472539, 26474850, 27809310, 28031536, 28443471, 28571770, 30121621, 30366079, 30628071, 31676788, 31754343		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26617801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26796749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29563811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20423907, 29799025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12584565, 20010869, 28592245, 31083279		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17065410, 27819677, 30105876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15389813, 22710715, 26743006, 27036119, 29137265, 31600936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22325466, 25825983, 25843777, 28337380, 28383763, 28498439, 29870889, 30510446, 30674866		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26844702, 30127997, 31072448		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11850205, 15837624, 15955695, 20670430, 2142119, 23041612, 23100280, 24378390, 25325377, 25541715, 26796749, 26851004, 27059735, 28039715, 28498439, 28638088, 29563811, 30190576, 30327117		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30816471		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17786359		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11108132, 15523674, 20805990, 21147226, 9366524		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16306050		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19703903, 20087159, 23884313, 25365078	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32699307	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma of soft tissue	Melanoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	30477403		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	34821426	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15999345, 17548750, 18221628, 19548263, 20943350, 21215389, 22152193, 23619509, 29197324, 29722134, 31255680		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	20643483, 21937024, 22152193, 23269207, 23619509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	Pubtator	34193943	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19815709	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	40301946	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22077634, 28254846	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	12457397, 12851637, 14582139, 15999345, 18213625, 18317463, 19517574, 20957653, 21807415, 22574704		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	12851637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	20047710	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	20957653, 21807415, 22574704, 23537502, 24898566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motion Sickness	Motion Sickness	BEFREE	28230177		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	38147910	Associate	★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	15729701, 16444749, 26503699		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15467434, 21707582, 24416428, 33420361, 35380709	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21707582		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11571785, 18511806, 31146783		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18511806, 21152067, 31146783	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23100280		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29069780		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	16196046		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	19027736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35562411	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26573110	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10545204, 10728913, 11108132, 15729701, 16652146, 16982753, 17724745, 18300804, 20581861, 22510762, 23199525, 23252871, 23625515, 24559637, 25476123, 25541715, 25738364, 25825983, 25940704, 26163185, 26165403, 26796749, 27059735, 27721408, 27764830, 27801665, 27819677, 28009602, 28498439, 29041002, 29523765, 29533464, 29563811, 29755294, 29915361, 30581482, 30816471, 31083279, 31103249, 31276279, 9366524, 9420268		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	16786226, 22186421		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12368293, 17426037, 18342014, 19633294, 24488767, 30020827, 33028897	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15314161, 17124508, 17426037, 18342014, 23077641, 23565152, 24488767, 27845037, 28653600		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	15073328, 23555779, 25597433	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	21853033		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	14647436		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30056271		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22740515, 25325377		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18988190, 28170448		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24488767, 35805082, 38003551	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	38003551	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	25476123		★☆☆☆☆ Found in Text Mining only
Osteitis Fibrosa Disseminata	Fibrous dysplasia	BEFREE	22450860		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	40301946	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	31182934		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30661131		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37335694	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23403511, 27144433	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25605016, 27070462, 30154459, 31011522		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian Diseases	BEFREE	29089199		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18554190		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27819677, 30105876		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22596241, 24055910, 25277212, 27819677, 30069985, 33297760	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34155232	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28039715		★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic syndrome	Pubtator	36593607	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28366931, 28611284, 30019362, 31761328		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	29986767, 33443209	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	32770123	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	16598418		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	32111982	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	22570239		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31115532	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31704315		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26008971		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30018265		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	19218654		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30487761		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15389813, 22710715, 26743006, 27036119, 29137265, 31600936		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16820098, 19244110		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16820098, 18030357, 19047143, 20532174, 24437490, 24564736, 25548099, 26743006, 26944191, 31097763, 31600936, 33495313, 35595103, 37552603, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18204156, 22413812, 40508027	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	16079300	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20817778		★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	14582139		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26796749		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26796749, 28544385		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34646884	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	12566391, 15207239, 16786226, 28270572		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11884470, 19846884, 24792438, 29209219		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15077295		★☆☆☆☆ Found in Text Mining only
Rothmund-Thomson syndrome	Rothmund-Thomson Syndrome	BEFREE	12566391, 15207239, 16786226		★☆☆☆☆ Found in Text Mining only
Rubinstein-Taybi Syndrome	Rubinstein-Taybi Syndrome	BEFREE	22186421		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22510762		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	34193943, 34821426, 37097347	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	19561568, 20087159, 34193943, 34228212, 34821426, 35347249, 36959380	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10570922, 20100784, 22198373, 25043418, 26899345, 28477407, 31740729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	10570922, 22198373, 25043418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24148789	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	23055509	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31433522		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	14623261		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	20697351, 29523765		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	29932283		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23467345		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20564339		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22325466, 25740226, 25825983, 25843777, 28337380, 28383763, 28498439, 29870889, 30510446, 30674866		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22325466, 22539488, 25825983, 26088449, 34321174, 35421923, 36268034, 37929660	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	31510897	Associate	★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	31053641		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	19223551	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28039715	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25244400, 29467389, 33176626	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	25940704		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32128390, 35053370	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11099740, 12457397, 17258370, 17300755, 17548750, 18678793, 19194961, 19517574, 20643483, 21598377, 22152193, 22386572, 23844928, 24093582, 28225778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	23844928, 24006268, 24093582, 25059218, 25755794		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26844702, 30953603	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34499007	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35245485	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33388092	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34381164	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	16718354		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	23555779, 28129744	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	25476123		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30779069	Associate	★☆☆☆☆ Found in Text Mining only