Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1610
Gene name	D-amino acid oxidase
Gene symbol	DAO
Synonyms (NCBI Gene)	DAAODAMOXOXDA
Chromosome	12
Chromosome location	12q24.11
Summary	This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally o

47 Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724913	hsa-miR-4269	HITS-CLIP	19536157
MIRT724912	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT724911	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT724910	hsa-miR-4673	HITS-CLIP	19536157
MIRT724909	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT724908	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT724906	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT724907	hsa-miR-4656	HITS-CLIP	19536157
MIRT724905	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT724904	hsa-miR-4492	HITS-CLIP	19536157
MIRT724903	hsa-miR-4498	HITS-CLIP	19536157
MIRT724902	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT724901	hsa-miR-762	HITS-CLIP	19536157
MIRT724900	hsa-miR-4675	HITS-CLIP	19536157
MIRT724899	hsa-miR-4741	HITS-CLIP	19536157
MIRT724898	hsa-miR-3147	HITS-CLIP	19536157
MIRT724897	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT724896	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT724895	hsa-miR-4674	HITS-CLIP	19536157
MIRT724894	hsa-miR-1587	HITS-CLIP	19536157
MIRT724893	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT724913	hsa-miR-4269	HITS-CLIP	19536157
MIRT724912	hsa-miR-6715b-5p	HITS-CLIP	19536157
MIRT724911	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT724910	hsa-miR-4673	HITS-CLIP	19536157
MIRT724909	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT724908	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT724906	hsa-miR-3925-3p	HITS-CLIP	19536157
MIRT724907	hsa-miR-4656	HITS-CLIP	19536157
MIRT724905	hsa-miR-6829-5p	HITS-CLIP	19536157
MIRT724904	hsa-miR-4492	HITS-CLIP	19536157
MIRT724903	hsa-miR-4498	HITS-CLIP	19536157
MIRT724902	hsa-miR-5001-5p	HITS-CLIP	19536157
MIRT724901	hsa-miR-762	HITS-CLIP	19536157
MIRT724900	hsa-miR-4675	HITS-CLIP	19536157
MIRT724899	hsa-miR-4741	HITS-CLIP	19536157
MIRT724898	hsa-miR-3147	HITS-CLIP	19536157
MIRT724897	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT724896	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT724895	hsa-miR-4674	HITS-CLIP	19536157
MIRT724894	hsa-miR-1587	HITS-CLIP	19536157
MIRT724893	hsa-miR-3620-5p	HITS-CLIP	19536157
MIRT2209041	hsa-miR-1	CLIP-seq
MIRT2209042	hsa-miR-206	CLIP-seq
MIRT2209043	hsa-miR-3673	CLIP-seq
MIRT2209044	hsa-miR-490-5p	CLIP-seq
MIRT2209045	hsa-miR-613	CLIP-seq

50 Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003884	Function	D-amino-acid oxidase activity	IBA
GO:0003884	Function	D-amino-acid oxidase activity	IDA	12364586, 16616139, 17303072, 18544534, 19309736, 20567862, 20603179, 23219954, 29274788, 29326945, 32730563
GO:0003884	Function	D-amino-acid oxidase activity	IEA
GO:0003884	Function	D-amino-acid oxidase activity	IMP	29274788
GO:0005515	Function	Protein binding	IPI	12364586, 20521334, 21679769, 21988832, 24722188, 25416956, 28514442, 29274788, 31515488, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17880399
GO:0005737	Component	Cytoplasm	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	21679769
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IDA	17684499, 18544534, 21679769, 23219954, 31799256
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005782	Component	Peroxisomal matrix	ISS
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IDA	18544534, 31799256
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006551	Process	L-leucine metabolic process	IEA
GO:0006562	Process	L-proline catabolic process	IBA
GO:0006562	Process	L-proline catabolic process	IDA	16616139
GO:0007586	Process	Digestion	IEA
GO:0007586	Process	Digestion	ISS
GO:0008718	Function	D-amino-acid dehydrogenase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019478	Process	D-amino acid catabolic process	IDA	29274788
GO:0036088	Process	D-serine catabolic process	IBA
GO:0036088	Process	D-serine catabolic process	IDA	18544534
GO:0042416	Process	Dopamine biosynthetic process	IDA	17303072
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IPI	16616139, 19309736
GO:0042995	Component	Cell projection	IEA
GO:0043799	Function	Glycine oxidase activity	IEA
GO:0045202	Component	Synapse	IEA
GO:0046416	Process	D-amino acid metabolic process	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048786	Component	Presynaptic active zone	ISS
GO:0051873	Process	Killing by host of symbiont cells	IEA
GO:0055130	Process	D-alanine catabolic process	IBA
GO:0055130	Process	D-alanine catabolic process	IDA	16616139, 20603179
GO:0055130	Process	D-alanine catabolic process	IEA
GO:0070178	Process	D-serine metabolic process	IDA	21679769
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	IEA
GO:0070945	Process	Neutrophil-mediated killing of gram-negative bacterium	ISS
GO:0071949	Function	FAD binding	IDA	16616139, 19309736, 20521334, 20603179, 29326945, 32730563
GO:0071949	Function	FAD binding	IEA
GO:0071949	Function	FAD binding	IMP	29274788
GO:0170035	Process	L-amino acid catabolic process	IEA
GO:0170040	Process	Proteinogenic amino acid catabolic process	IEA

MIM	HGNC	e!Ensembl
124050	2671	ENSG00000110887

P14920

Protein name

D-amino-acid oxidase (DAAO) (DAMOX) (DAO) (EC 1.4.3.3)

Protein function

Catalyzes the oxidative deamination of D-amino acids with broad substrate specificity (PubMed:16616139, PubMed:17088322, PubMed:17303072, PubMed:18544534, PubMed:20368421, PubMed:20567862, PubMed:20603179, PubMed:22203986, PubMed:23219954, PubMe

PDB

2DU8 , 2E48 , 2E49 , 2E4A , 2E82 , 3CUK , 3G3E , 3W4I , 3W4J , 3W4K , 3ZNN , 3ZNO , 3ZNP , 3ZNQ , 4QFC , 4QFD , 5ZJ9 , 5ZJA , 6KBP , 7U9S , 7U9U , 8HY5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01266	DAO	2 → 329	FAD dependent oxidoreductase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the cerebellum, in astrocytes of the cortex, in motor neurons and fibers of the lumbar spinal cord (at protein level) (PubMed:17880399, PubMed:18544534, PubMed:18560437, PubMed:24138986, PubMed:34041270). Expressed in gobl

Sequence

MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL

Sequence length

347

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Glycine, serine and threonine metabolism	Glyoxylate metabolism and glycine degradation
Arginine and proline metabolism	Peroxisomal protein import
D-Amino acid metabolism
Metabolic pathways
Peroxisome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (12)
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic lateral sclerosis	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar ClinGen, Disgenet, GenCC, Orphanet ClinGen, Disgenet, GenCC, Orphanet ClinGen, Disgenet, GenCC, Orphanet	20368421, 24085347	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	17629951	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DAO-related disorder	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	18583979	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (64)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	ORPHANET_DG	20368421, 24085347		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GENOMICS_ENGLAND_DG	20368421		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	23755159, 33051492	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25604957, 27773581, 28025800, 29194436, 29404340, 29487852, 30206963		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	HPO_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Anxiety	Anxiety Disorder	BEFREE	19729970, 21471957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	21471957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19729970, 21471957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29290484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17629951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	17629951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	14966479, 16203746, 18165970, 18628682, 21421061, 22239582		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16203746, 16380905, 18165970, 21421061, 22239582		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	16380905	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	18165970		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	16380905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	PSYGENET_DG	16380905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38297313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29093468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33540681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26989676, 31298558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Darier Disease	Darier disease	Pubtator	26440917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19729970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exostoses	Exostoses	Pubtator	34582124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33540681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21921941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31298558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29093468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31671112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29273565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngospasm	Laryngospasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	14966479, 18165970, 18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	14966479, 18165970, 18628682		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	PSYGENET_DG	18165970		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	14966479, 18165970, 18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	14966479, 18165970, 18628682		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	14966479, 18165970		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	14966479, 18165970		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	14966479, 18165970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31706037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19729970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28477547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25612138, 27130307, 29475774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	27130307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17890006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	17890006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	26440917	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21921941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	17890006, 21391259, 22239582, 29326614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32818236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hyperoxaluria, type I	Hyperoxaluria	BEFREE	2516173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	17890006, 21391259, 22239582, 29326614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	21391259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	17492767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12364586, 14966479, 15464270, 15744031, 15953485, 16203746, 16314870, 16828464, 16842973, 17055463, 17250995, 17336946, 17408693, 17492767, 17627036 View all (34 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12364586, 15464270, 17250995, 17336946, 17492767, 17890006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18583979		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21471957, 23219954, 26440917	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	31524230		★★★★★ ★☆☆☆☆ Found in Text Mining only

DAO (D-amino acid oxidase)

Save This Analysis