Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	80237
Gene name	Elongation factor for RNA polymerase II 3
Gene symbol	ELL3
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q15.3

15 Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT734678	hsa-miR-665	RNA-seqqRT-PCRImmunocytochemistry (ICC)ELISA	31775315
MIRT960800	hsa-miR-3545-5p	CLIP-seq
MIRT960801	hsa-miR-4310	CLIP-seq
MIRT960802	hsa-miR-4328	CLIP-seq
MIRT960803	hsa-miR-4662a-5p	CLIP-seq
MIRT960804	hsa-miR-4716-5p	CLIP-seq
MIRT960805	hsa-miR-4775	CLIP-seq
MIRT960806	hsa-miR-4781-3p	CLIP-seq
MIRT960807	hsa-miR-548n	CLIP-seq
MIRT960808	hsa-miR-548t	CLIP-seq
MIRT960809	hsa-miR-579	CLIP-seq
MIRT960810	hsa-miR-590-3p	CLIP-seq
MIRT1984758	hsa-miR-3591-3p	CLIP-seq
MIRT2219626	hsa-miR-375	CLIP-seq
MIRT2219627	hsa-miR-4326	CLIP-seq

42 Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IBA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	ISS
GO:0005515	Function	Protein binding	IPI	21729782, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	10882741
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006354	Process	DNA-templated transcription elongation	IDA	10882741
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	ISS
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	10882741
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0007283	Process	Spermatogenesis	NAS	10882741
GO:0008023	Component	Transcription elongation factor complex	IBA
GO:0008023	Component	Transcription elongation factor complex	IDA	22195968
GO:0008023	Component	Transcription elongation factor complex	IEA
GO:0008023	Component	Transcription elongation factor complex	NAS	10882741
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	IEA
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	ISS
GO:0016607	Component	Nuclear speck	IDA
GO:0030054	Component	Cell junction	IDA
GO:0032786	Process	Positive regulation of DNA-templated transcription, elongation	IDA	10882741
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IBA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0042795	Process	SnRNA transcription by RNA polymerase II	IBA
GO:0042795	Process	SnRNA transcription by RNA polymerase II	IMP	22195968
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10882741
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0048863	Process	Stem cell differentiation	ISS
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072331	Process	Signal transduction by p53 class mediator	IEA
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IEA
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
609885	23113	ENSG00000128886

Q9HB65

Protein name

RNA polymerase II elongation factor ELL3

Protein function

Enhancer-binding elongation factor that specifically binds enhancers in embryonic stem cells (ES cells), marks them, and is required for their future activation during stem cell specification. Does not only bind to enhancer regions of active gen

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07303	Occludin_ELL	291 → 392	Occludin homology domain	Domain
PF10390	ELL	14 → 125	RNA polymerase II elongation factor ELL	Family

Tissue specificity

TISSUE SPECIFICITY: Testis specific. {ECO:0000269|PubMed:10882741}.

Sequence

MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRL
PGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIP
APSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSS
REHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSP
LQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQ
HAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFR
KQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS

Sequence length

397

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Viral life cycle - HIV-1	RNA polymerase II transcribes snRNA genes

ELL3 (elongation factor for RNA polymerase II 3)

Bookmark This Gene