CNOT11 (CCR4-NOT transcription complex subunit 11)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55571
Gene name CCR4-NOT transcription complex subunit 11
Gene symbol CNOT11
Synonyms (NCBI Gene)
C2orf29C40
Chromosome 2
Chromosome location 2q11.2
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT023186 hsa-miR-124-3p Microarray 18668037
MIRT050217 hsa-miR-25-3p CLASH 23622248
MIRT048199 hsa-miR-196a-5p CLASH 23622248
MIRT045470 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000289 Process Nuclear-transcribed mRNA poly(A) tail shortening NAS 31320642
GO:0005515 Function Protein binding IPI 23232451, 26496610, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620509 25217 ENSG00000158435
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKZ1
Protein name CCR4-NOT transcription complex subunit 11
Protein function Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiati
PDB 8BFH , 8BFI , 8BFJ , 8FY3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10155 CNOT11 371 → 495 CCR4-NOT transcription complex subunit 11 Family
Sequence 
MPGGGASAASGRLLTAAEQRGSREAAGSASRSGFGGSGGGRGGASGPGSGSGGPGGPAGR
MSLTPKELSSLLSIISEEAGGGSTFEGLSTAFHHYFSKADHFRLGSVLVMLLQQPDLLPS
AAQRLTALYLLWEMYRTEPLAANPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPP
EKFFLSQLMLAPPRELFKKTPRQIALMDVGNMGQSVDISGLQLALAERQSELPTQSKASF
PSILSDPDPDSSNSGFDSSVASQITEALVSGPKPPIESHFRPEFIRPPPPLHICEDELAW
LNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGELEKDPKLVYHI
GLTPAKLPDLVENNPLVAIEMLLKLMQSSQITEYFSVLVNMDMSLHSMEVVNRLTTAVDL
PPEFIHLYISNCISTCEQIKDKYMQNRLVRLVCVFLQSLIRNKIINVQDLFIEVQAFCIE
FSRIREAAGLFRLLKTLDTGETPSETKMSK
Sequence length 510
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Deadenylation of mRNA
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
Sort by:
TNKS1BP1 2 shared pathwaysDeadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 2 shared pathways including Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain. CNOT1 2 shared pathwaysDeadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 2 shared pathways including Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain. CNOT6L 2 shared pathwaysDeadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 2 shared pathways including Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain. CNOT10 2 shared pathwaysDeadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 2 shared pathways including Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain. CNOT7 2 shared pathwaysDeadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 2 shared pathways including Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain.
Schizophrenia Linked via 2 of 5 related genesCNOT1, CNOT7 Alzheimer disease Linked via 1 of 5 related genesTNKS1BP1 Color vision deficiency Linked via 1 of 5 related genesTNKS1BP1 Gout Linked via 1 of 5 related genesTNKS1BP1 Hypertrophic cardiomyopathy Linked via 1 of 5 related genesTNKS1BP1