CNOT10 (CCR4-NOT transcription complex subunit 10)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 25904
• Gene name: CCR4-NOT transcription complex subunit 10
• Gene symbol: CNOT10
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3p22.3

miRNA Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020673	hsa-miR-155-5p	Proteomics	18668040
MIRT039734	hsa-miR-615-3p	CLASH	23622248
MIRT900264	hsa-miR-1298	CLIP-seq
MIRT900265	hsa-miR-197	CLIP-seq
MIRT900266	hsa-miR-3614-3p	CLIP-seq
MIRT900267	hsa-miR-3662	CLIP-seq
MIRT900268	hsa-miR-3689a-5p	CLIP-seq
MIRT900269	hsa-miR-3689b	CLIP-seq
MIRT900270	hsa-miR-3689e	CLIP-seq
MIRT900271	hsa-miR-3689f	CLIP-seq
MIRT900272	hsa-miR-412	CLIP-seq
MIRT900273	hsa-miR-4679	CLIP-seq
MIRT900274	hsa-miR-664	CLIP-seq
MIRT900265	hsa-miR-197	CLIP-seq
MIRT900266	hsa-miR-3614-3p	CLIP-seq
MIRT900272	hsa-miR-412	CLIP-seq
MIRT900274	hsa-miR-664	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000289	Process	Nuclear-transcribed mRNA poly(A) tail shortening	NAS	31320642
GO:0005515	Function	Protein binding	IPI	17452450, 18377426, 21981923, 21984185, 23232451, 25959826, 32814053, 33961781, 34819669
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006402	Process	MRNA catabolic process	IBA
GO:0006417	Process	Regulation of translation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0017148	Process	Negative regulation of translation	IBA
GO:0030014	Component	CCR4-NOT complex	IBA
GO:0030014	Component	CCR4-NOT complex	IDA	19558367, 23232451
GO:0030014	Component	CCR4-NOT complex	IEA
GO:0030014	Component	CCR4-NOT complex	NAS	19558367
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA

Other IDs

• MIM: 620508
• HGNC: 23817
• e!Ensembl: ENSG00000182973

Protein

• UniProt ID: Q9H9A5
• Protein name: CCR4-NOT transcription complex subunit 10
• Protein function: Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiati
• PDB: 8BFI , 8FY3
• Sequence:

  MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDD
  YKIILNTAVAEFFKSNQTTTDNLRQTLNQLKNQVHSAVEEMDGLDDVENSMLYYNQAVIL
  YHLRQYTEAISVGEKLYQFIEPFEEKFAQAVCFLLVDLYILTYQAEKALHLLAVLEKMIS
  QGNNNKNGKNETGNNNNKDGSNHKAESGALIEAAKSKIHQYKVRAYIQMKSLKACKREIK
  SVMNTAGNSAPSLFLKSNFEYLRGNYRKAVKLLNSSNIAEHPGFMKTGECLRCMFWNNLG
  CIHFAMSKHNLGIFYFKKALQENDNVCAQLSAGSTDPGKKFSGRPMCTLLTNKRYELLYN
  CGIQLLHIGRPLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGI
  VQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPVASMEFAAICLRNALLLLPEEQQDPK
  QENGAKNSNQLGGNTESSESSETCSSKSHDGDKFIPAPPSSPLRKQELENLKCSILACSA
  YVALALGDNLMALNHADKLLQQPKLSGSLKFLGHLYAAEALISLDRISDAITHLNPENVT
  DVSLGISSNEQDQGSDKGENEAMESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYD
  KARKCLHQAASMIHPKEVPPEAILLAVYLELQNGNTQLALQIIKRNQLLPAVKTHSEVRK
  KPVFQPVHPIQPIQMPAFTTVQRK

• Sequence length: 744

Pathways

KEGG Pathway	Reactome Pathway
RNA degradation	Deadenylation of mRNA
	TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CNOT1 3 shared pathwaysRNA degradation, Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 3 shared pathways including RNA degradation, Deadenylation of mRNA. CNOT6L 3 shared pathwaysRNA degradation, Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 3 shared pathways including RNA degradation, Deadenylation of mRNA. CNOT7 3 shared pathwaysRNA degradation, Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 3 shared pathways including RNA degradation, Deadenylation of mRNA. CNOT2 3 shared pathwaysRNA degradation, Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 3 shared pathways including RNA degradation, Deadenylation of mRNA. CNOT3 3 shared pathwaysRNA degradation, Deadenylation of mRNA, TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain Related via 3 shared pathways including RNA degradation, Deadenylation of mRNA.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CNOT1	0	[]	3	["RNA degradation","Deadenylation of mRNA","TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain"]	0	[]
CNOT6L	0	[]	3	["RNA degradation","Deadenylation of mRNA","TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain"]	0	[]
CNOT7	0	[]	3	["RNA degradation","Deadenylation of mRNA","TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain"]	0	[]
CNOT2	0	[]	3	["RNA degradation","Deadenylation of mRNA","TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain"]	0	[]
CNOT3	0	[]	3	["RNA degradation","Deadenylation of mRNA","TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain"]	0	[]

Diseases Linked via Similar Genes

Neurodevelopmental disorder Linked via 3 of 5 related genesCNOT1, CNOT2, CNOT3 Non-specific syndromic intellectual disability Linked via 2 of 5 related genesCNOT1, CNOT3 Schizophrenia Linked via 2 of 5 related genesCNOT1, CNOT7 complex neurodevelopmental disorder Linked via 2 of 5 related genesCNOT1, CNOT3 Autism Linked via 1 of 5 related genesCNOT1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Neurodevelopmental disorder	3	["CNOT1","CNOT2","CNOT3"]
Non-specific syndromic intellectual disability	2	["CNOT1","CNOT3"]
Schizophrenia	2	["CNOT1","CNOT7"]
complex neurodevelopmental disorder	2	["CNOT1","CNOT3"]
Autism	1	["CNOT1"]