CDH18 (cadherin 18)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1016
• Gene name: Cadherin 18
• Gene symbol: CDH18
• Synonyms (NCBI Gene): CDH14, CDH14L, CDH24
• Chromosome: 5
• Chromosome location: 5p14.3
• Summary: This gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membra

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051690	hsa-let-7e-5p	CLASH	23622248
MIRT2197344	hsa-miR-198	CLIP-seq
MIRT2197345	hsa-miR-3691-3p	CLIP-seq
MIRT2197346	hsa-miR-4267	CLIP-seq
MIRT2197347	hsa-miR-4277	CLIP-seq
MIRT2197348	hsa-miR-516a-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008013	Function	Beta-catenin binding	IBA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0034332	Process	Adherens junction organization	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0045296	Function	Cadherin binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IEA

Other IDs

• MIM: 603019
• HGNC: 1757
• e!Ensembl: ENSG00000145526

Protein

• UniProt ID: Q13634
• Protein name: Cadherin-18 (Cadherin-14)
• Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00028	Cadherin	388 → 479	Cadherin domain	Domain
  PF00028	Cadherin	164 → 259	Cadherin domain	Domain
  PF00028	Cadherin	273 → 374	Cadherin domain	Domain
  PF00028	Cadherin	58 → 150	Cadherin domain	Domain
  PF00028	Cadherin	492 → 589	Cadherin domain	Domain
  PF01049	Cadherin_C	637 → 784	Cadherin cytoplasmic region	Family

• Sequence:

  MKITSTSCICPVLVCLCFVQRCYGTAHHSSIKVMRNQTKHIEGETEVHHRPKRGWVWNQF
  FVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQ
  KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMGTSVLQ
  VTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKD
  MAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSN
  ADMTYSIINGDGMGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSH
  LGPFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVLAQDPDSTNSLVRYF
  INYNVEDDRFFNIDANTGTIRTTKVLDREETPWYNITVTASEIDNPDLLSHVTVGIRVLD
  VNDNPPELAREYDIIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNFTLK
  DNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTC
  HAEAFLSSAGLSTGALIAILLCVLILLAIVVLFITLRRSKKEPLIISEEDVRENVVTYDD
  EGGGEEDTEAFDITALRNPSAAEELKYRRDIRPEVKLTPRHQTSSTLESIDVQEFIKQRL
  AEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDWGPEFKKLAEL
  YGEIESERTT

• Sequence length: 790

Pathways

Reactome Pathway:

Adherens junctions interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (19)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANTIPHOSPHOLIPID SYNDROME	—	GWAS catalog	28424481	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APRAXIA, DEVELOPMENTAL VERBAL	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CDH18-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood apraxia of speech	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	GWAS catalog	34404834	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	28498854	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	20800221, 37464041	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITH AURA	—	GWAS catalog	34380431	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIALOLITHIASIS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (17)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ameloblastoma	Ameloblastoma	BEFREE	17300670		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	27120335	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37025097	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	37780629	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37780629	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30078018		★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	30342662	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	28498854		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	GWASCAT_DG	25642632		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34166375	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	23628382, 30852652	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23628382		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	34380431	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	39238003	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29207108		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30368729	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37025097	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

KCNF1 2 shared diseasesGastric ulcer, Gastritis 2 shared evidence sourcesGWAS catalog (Gastric ulcer), GWAS catalog (Gastritis) Related via 2 shared diseases including Gastric ulcer, Gastritis — evidence mostly GWAS catalog. ZNF385B 2 shared diseasesGastric ulcer, Gastritis 2 shared evidence sourcesGWAS catalog (Gastric ulcer), GWAS catalog (Gastritis) Related via 2 shared diseases including Gastric ulcer, Gastritis — evidence mostly GWAS catalog. SORCS2 2 shared diseasesGastric ulcer, Gastritis 2 shared evidence sourcesGWAS catalog (Gastric ulcer), GWAS catalog (Gastritis) Related via 2 shared diseases including Gastric ulcer, Gastritis — evidence mostly GWAS catalog. NOS2 2 shared diseasesEmphysema, Gastric ulcer Related via 2 shared diseases including Emphysema, Gastric ulcer. HLA-DQB1 3 shared diseasesAntiphospholipid syndrome, Eye disease, Gastritis 2 shared evidence sourcesGWAS catalog (Eye disease), GWAS catalog (Gastritis) Related via 3 shared diseases including Antiphospholipid syndrome, Eye disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
KCNF1	2	["Gastric ulcer","Gastritis"]	0	[]	2	["GWAS catalog (Gastric ulcer)","GWAS catalog (Gastritis)"]
ZNF385B	2	["Gastric ulcer","Gastritis"]	0	[]	2	["GWAS catalog (Gastric ulcer)","GWAS catalog (Gastritis)"]
SORCS2	2	["Gastric ulcer","Gastritis"]	0	[]	2	["GWAS catalog (Gastric ulcer)","GWAS catalog (Gastritis)"]
NOS2	2	["Emphysema","Gastric ulcer"]	0	[]	0	[]
HLA-DQB1	3	["Antiphospholipid syndrome","Eye disease","Gastritis"]	0	[]	2	["GWAS catalog (Eye disease)","GWAS catalog (Gastritis)"]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 4 of 5 related genesZNF385B, SORCS2, NOS2, HLA-DQB1 Schizophrenia Linked via 3 of 5 related genesZNF385B, NOS2, HLA-DQB1 Crohn disease Linked via 3 of 5 related genesSORCS2, NOS2, HLA-DQB1 Alzheimer disease Linked via 2 of 5 related genesKCNF1, ZNF385B Color vision deficiency Linked via 2 of 5 related genesZNF385B, SORCS2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	4	["ZNF385B","SORCS2","NOS2","HLA-DQB1"]
Schizophrenia	3	["ZNF385B","NOS2","HLA-DQB1"]
Crohn disease	3	["SORCS2","NOS2","HLA-DQB1"]
Alzheimer disease	2	["KCNF1","ZNF385B"]
Color vision deficiency	2	["ZNF385B","SORCS2"]