NOS2 (nitric oxide synthase 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4843
• Gene name: Nitric oxide synthase 2
• Gene symbol: NOS2
• Synonyms (NCBI Gene): HEP-NOS, INOS, NOS, NOS2A
• Chromosome: 17
• Chromosome location: 17q11.2
• Summary: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducibl

miRNA Show/Hide all (23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007347	hsa-miR-26a-5p	qRT-PCR, Western blot	23338972
MIRT007347	hsa-miR-26a-5p	Luciferase reporter assay	26854724
MIRT007347	hsa-miR-26a-5p	Luciferase reporter assay	26854724
MIRT732802	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33318876
MIRT737162	hsa-miR-939-5p	qRT-PCR	33368266
MIRT755532	hsa-miR-149-5p	qRT-PCR	36250208
MIRT755532	hsa-miR-149-5p	qRT-PCR	36250208
MIRT1189580	hsa-miR-1291	CLIP-seq
MIRT1189581	hsa-miR-146b-3p	CLIP-seq
MIRT1189582	hsa-miR-4330	CLIP-seq
MIRT2283906	hsa-miR-2682	CLIP-seq
MIRT2283907	hsa-miR-323-5p	CLIP-seq
MIRT2283908	hsa-miR-3614-5p	CLIP-seq
MIRT2283909	hsa-miR-3616-5p	CLIP-seq
MIRT2283910	hsa-miR-3647-5p	CLIP-seq
MIRT2283911	hsa-miR-3714	CLIP-seq
MIRT2283912	hsa-miR-4457	CLIP-seq
MIRT2283913	hsa-miR-449c	CLIP-seq
MIRT2283914	hsa-miR-4635	CLIP-seq
MIRT2283915	hsa-miR-4731-3p	CLIP-seq
MIRT2283916	hsa-miR-4801	CLIP-seq
MIRT2283917	hsa-miR-573	CLIP-seq
MIRT2283918	hsa-miR-876-3p	CLIP-seq

Transcription factors Show/Hide all (22)

Transcription factor	Regulation	Reference
APC	Activation	11935128
FOS	Activation	12788789
FOS	Repression	9776360
FOSL2	Activation	12788789
IKBKB	Repression	17478759
JUN	Activation	12788789
JUN	Repression	9776360
JUN	Unknown	14962367
JUND	Activation	12788789
KLF6	Activation	12590140
KLF6	Unknown	23831683
MTA1	Activation	20022949
NFKB1	Activation	15350552;17081374;17720813;18057724
NFKB1	Unknown	11438703;15170030;16283237;16318585;19766095
NFKBIA	Repression	17478759
RELA	Activation	15350552;17081374;17720813;18057724
RELA	Unknown	15170030;16283237;16318585;19766095;9712833
STAT1	Activation	12586443
STAT1	Unknown	16318585
STAT2	Activation	12586443
XBP1	Unknown	20637858
YY1	Unknown	20430007

Gene ontology (GO) Show/Hide all (81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001912	Process	Positive regulation of leukocyte mediated cytotoxicity	TAS	10450191
GO:0002227	Process	Innate immune response in mucosa	NAS	18390757
GO:0004517	Function	Nitric-oxide synthase activity	IBA
GO:0004517	Function	Nitric-oxide synthase activity	IDA	7504305, 7682706, 35772285
GO:0004517	Function	Nitric-oxide synthase activity	IEA
GO:0004517	Function	Nitric-oxide synthase activity	TAS
GO:0005515	Function	Protein binding	IPI	12855682, 21199876, 25417112
GO:0005516	Function	Calmodulin binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	9916929, 12085352
GO:0005737	Component	Cytoplasm	IEA
GO:0005777	Component	Peroxisome	IDA	12085352
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IMP	7504305
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0006527	Process	L-arginine catabolic process	IBA
GO:0006527	Process	L-arginine catabolic process	IDA	7504305
GO:0006527	Process	L-arginine catabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	ISS
GO:0006809	Process	Nitric oxide biosynthetic process	IBA
GO:0006809	Process	Nitric oxide biosynthetic process	IDA	7504305, 7682706
GO:0006809	Process	Nitric oxide biosynthetic process	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0007263	Process	Nitric oxide mediated signal transduction	IBA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009617	Process	Response to bacterium	NAS	12085352
GO:0009725	Process	Response to hormone	IBA
GO:0010181	Function	FMN binding	IBA
GO:0010181	Function	FMN binding	IEA
GO:0010181	Function	FMN binding	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IGI	12085352
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0018119	Process	Peptidyl-cysteine S-nitrosylation	ISS
GO:0020037	Function	Heme binding	IEA
GO:0020037	Function	Heme binding	ISS
GO:0030863	Component	Cortical cytoskeleton	IEA
GO:0032310	Process	Prostaglandin secretion	IDA	19688109
GO:0032496	Process	Response to lipopolysaccharide	IBA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19688109
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19688109
GO:0034617	Function	Tetrahydrobiopterin binding	IEA
GO:0034617	Function	Tetrahydrobiopterin binding	ISS
GO:0034618	Function	Arginine binding	IEA
GO:0034618	Function	Arginine binding	ISS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IMP	7544003
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	IMP	9284131
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043457	Process	Regulation of cellular respiration	TAS	10450191
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	TAS
GO:0045776	Process	Negative regulation of blood pressure	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	ISS
GO:0050661	Function	NADP binding	IEA
GO:0050661	Function	NADP binding	TAS	7504305
GO:0050796	Process	Regulation of insulin secretion	IMP	8383325
GO:0050829	Process	Defense response to Gram-negative bacterium	NAS	18390757
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IDA	19688109

Other IDs

• MIM: 163730
• HGNC: 7873
• e!Ensembl: ENSG00000007171

Protein

• UniProt ID: P35228
• Protein name: Nitric oxide synthase, inducible (EC 1.14.13.39) (Hepatocyte NOS) (HEP-NOS) (Inducible NO synthase) (Inducible NOS) (iNOS) (NOS type II) (Peptidyl-cysteine S-nitrosylase NOS2)
• Protein function: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body (PubMed:7504305, PubMed:7531687, PubMed:7544004, PubMed:7682706). In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitr
• PDB: 1NSI , 2LL6 , 2NSI , 3E7G , 3EJ8 , 3HR4 , 4CX7 , 4NOS , 5TP6 , 5XN3 , 6JWM , 6JWN , 6KEY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00175	NAD_binding_1	979 → 1093	Oxidoreductase NAD-binding domain	Domain
  PF00258	Flavodoxin_1	541 → 672	Flavodoxin	Domain
  PF00667	FAD_binding_1	725 → 947	FAD binding domain	Domain
  PF02898	NO_synthase	135 → 497	Nitric oxide synthase, oxygenase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the liver, retina, bone cells and airway epithelial cells of the lung. Not expressed in the platelets. Expressed in chondrocytes (PubMed:7504305). {ECO:0000269|PubMed:7504305}.
• Sequence:

  MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
  VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
  TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
  LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
  RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
  RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
  GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
  AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
  LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
  ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
  NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
  ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
  SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
  PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
  LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
  PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
  VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
  EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
  VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
  VAVQPSSLEMSAL

• Sequence length: 1153

Pathways

KEGG Pathway	Reactome Pathway
Arginine biosynthesis	ROS and RNS production in phagocytes
Arginine and proline metabolism	Nitric oxide stimulates guanylate cyclase
Metabolic pathways	Interleukin-4 and Interleukin-13 signaling
Calcium signaling pathway	Peroxisomal protein import
HIF-1 signaling pathway	Inhibition of nitric oxide production
Peroxisome
Apelin signaling pathway
Relaxin signaling pathway
Alzheimer disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Pertussis
Leishmaniasis
Chagas disease
Toxoplasmosis
Amoebiasis
Tuberculosis
Pathways in cancer
Small cell lung cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (82)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	23749187, 26974007, 30946743	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ARCH SYNDROMES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD, Disgenet CTD, Disgenet	20953189	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASBESTOSIS	—	CTD, Disgenet CTD, Disgenet	12160931	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	19800904	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	20720404	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	35663546	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	18563708	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONNEVIE-ULLRICH SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN EDEMA	—	CTD	19374494	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	28642177	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	17394460, 9778187	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	15631943	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	15774269	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	19587355	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGIOCARCINOMA	—	CTD	16818635	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLANGITIS, SCLEROSING	—	CTD, Disgenet CTD, Disgenet	12612912	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	12612912, 20626112	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	30026087	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	17449036, 8698225	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	16105666, 21081470	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CURLING ULCER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	16959961	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	CTD, Disgenet CTD, Disgenet	12481160, 17045617	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	24465666	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	15264214	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC ULCER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	19168511	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC INSUFFICIENCY	—	CTD	30026087	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	30026087	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	17989504, 19300402	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	12646421	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	18605955, 25101153, 27292124	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	25574825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL DISEASES	—	CTD, Disgenet CTD, Disgenet	11713966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	18441258	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	30026087	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	19784758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	12460898, 22369883	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34586374	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, resistance to	protective	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, severe, resistance to	protective	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, susceptibility to	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	25101153	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	16157314	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	10090345, 11489778	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	10620138, 10909967	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NOS2-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	25634431	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	20953189, 23143594, 25574825, 25903422, 26626624, 26974007, 33385400, 38757301, 39024449, 39883516, 39885523	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	26626624, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	26626624, 30552173, 35507331, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	21843929	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
repeat number of microsatellite	association	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	19559095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	17138957, 20035746	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	20149694	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	10620138	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	20083630	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	19751225	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TURNER SYNDROME	—	CTD, Disgenet CTD, Disgenet	25101153	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	33385400	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	26207612	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NOS3 15 shared diseasesAtherosclerosis, Biliary cirrhosis, Cholelithiasis, Obstructive airway disease, Liver cirrhosis, Congestive heart failure, Esophageal neoplasms, Gastric ulcer, Hepatic insufficiency, Hepatomegaly, Kidney failure, Biliary cholangitis +3 more 8 shared pathwaysArginine biosynthesis, Arginine and proline metabolism, Calcium signaling pathway, HIF-1 signaling pathway, Apelin signaling pathway, Relaxin signaling pathway, ROS and RNS production in phagocytes, Nitric oxide stimulates guanylate cyclase 26 shared evidence sourcesDisgenet (Asthma), CTD (Atherosclerosis), Disgenet (Atherosclerosis), Disgenet (Biliary cirrhosis), CTD (Cholelithiasis), Disgenet (Cholelithiasis), Disgenet (Obstructive airway disease), Disgenet (Congestive heart failure), Disgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), CTD (Esophageal neoplasms), CTD (Hypertension) +14 more Related via 15 shared diseases including Atherosclerosis, Biliary cirrhosis — evidence mostly Disgenet. CAT 13 shared diseasesBonnevie-ullrich syndrome, Brain ischemia, Cholelithiasis, Liver cirrhosis, Congestive heart failure, Gastric ulcer, Seizures, Hyperemia, Kidney failure, Marfan syndrome, Necrosis, Status epilepticus +1 more 2 shared pathwaysPeroxisome, Peroxisomal protein import 30 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), Disgenet (Bonnevie-ullrich syndrome), CTD (Brain ischemia), Disgenet (Brain ischemia), CTD (Cholelithiasis), Disgenet (Cholelithiasis), Disgenet (Congestive heart failure), Disgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), CTD (Hypertension), Disgenet (Gastric ulcer) +18 more Related via 13 shared diseases including Bonnevie-ullrich syndrome, Brain ischemia — evidence mostly Disgenet. PTGS2 19 shared diseasesAtherosclerosis, Brain injuries, Brain ischemia, Cerebrovascular disorder, Cholangiocarcinoma, Colitis, Obstructive airway disease, Liver cirrhosis, Colonic neoplasms, Congestive heart failure, Curling ulcer, Duodenal ulcer +7 more 3 shared pathwaysLeishmaniasis, Small cell lung cancer, Interleukin-4 and Interleukin-13 signaling 33 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), CTD (Atherosclerosis), Disgenet (Atherosclerosis), CTD (Brain injuries), CTD (Brain ischemia), Disgenet (Brain ischemia), Disgenet (Cerebrovascular disorder), CTD (Cholangiocarcinoma), Disgenet (Colitis), Disgenet (Kidney disease), Disgenet (Obstructive airway disease) +21 more Related via 19 shared diseases including Atherosclerosis, Brain injuries — evidence mostly Disgenet. IL1B 17 shared diseasesAsbestosis, Brain injuries, Brain ischemia, Cerebrovascular disorder, Cholelithiasis, Colitis, Obstructive airway disease, Colonic neoplasms, Congestive heart failure, Gastric ulcer, Seizures, Hyperalgesia +5 more 6 shared pathwaysPertussis, Leishmaniasis, Chagas disease, Amoebiasis, Tuberculosis, Interleukin-4 and Interleukin-13 signaling 34 shared evidence sourcesCTD (Asbestosis), Disgenet (Asbestosis), Disgenet (Asthma), CTD (Asthma), CTD (Brain injuries), CTD (Brain ischemia), Disgenet (Brain ischemia), Disgenet (Cerebrovascular disorder), CTD (Cholelithiasis), Disgenet (Cholelithiasis), Disgenet (Colitis), Disgenet (Obstructive airway disease) +22 more Related via 17 shared diseases including Asbestosis, Brain injuries — evidence mostly Disgenet. RELA 12 shared diseasesBiliary cirrhosis, Brain injuries, Brain ischemia, Cholelithiasis, Colitis, Liver cirrhosis, Colonic neoplasms, Hepatic insufficiency, Hepatomegaly, Kidney failure, Biliary cholangitis, Urethral obstruction 9 shared pathwaysHIF-1 signaling pathway, Relaxin signaling pathway, Pertussis, Leishmaniasis, Chagas disease, Toxoplasmosis, Amoebiasis, Tuberculosis, Small cell lung cancer 16 shared evidence sourcesDisgenet (Biliary cirrhosis), CTD (Brain injuries), CTD (Brain ischemia), Disgenet (Brain ischemia), CTD (Cholelithiasis), Disgenet (Cholelithiasis), Disgenet (Colitis), CTD (Colitis), CTD (Colonic neoplasms), CTD (Hypertension), CTD (Hepatic insufficiency), CTD (Hepatomegaly) +4 more Related via 12 shared diseases including Biliary cirrhosis, Brain injuries — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NOS3	15	["Atherosclerosis","Biliary cirrhosis","Cholelithiasis","Obstructive airway disease","Liver cirrhosis","Congestive heart failure","Esophageal neoplasms","Gastric ulcer","Hepatic insufficiency","Hepatomegaly","Kidney failure","Biliary cholangitis"]	8	["Arginine biosynthesis","Arginine and proline metabolism","Calcium signaling pathway","HIF-1 signaling pathway","Apelin signaling pathway","Relaxin signaling pathway","ROS and RNS production in phagocytes","Nitric oxide stimulates guanylate cyclase"]	26	["Disgenet (Asthma)","CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","Disgenet (Biliary cirrhosis)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","Disgenet (Obstructive airway disease)","Disgenet (Congestive heart failure)","Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","CTD (Esophageal neoplasms)","CTD (Hypertension)"]
CAT	13	["Bonnevie-ullrich syndrome","Brain ischemia","Cholelithiasis","Liver cirrhosis","Congestive heart failure","Gastric ulcer","Seizures","Hyperemia","Kidney failure","Marfan syndrome","Necrosis","Status epilepticus"]	2	["Peroxisome","Peroxisomal protein import"]	30	["Disgenet (Asthma)","CTD (Asthma)","Disgenet (Bonnevie-ullrich syndrome)","CTD (Brain ischemia)","Disgenet (Brain ischemia)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","Disgenet (Congestive heart failure)","Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","CTD (Hypertension)","Disgenet (Gastric ulcer)"]
PTGS2	19	["Atherosclerosis","Brain injuries","Brain ischemia","Cerebrovascular disorder","Cholangiocarcinoma","Colitis","Obstructive airway disease","Liver cirrhosis","Colonic neoplasms","Congestive heart failure","Curling ulcer","Duodenal ulcer"]	3	["Leishmaniasis","Small cell lung cancer","Interleukin-4 and Interleukin-13 signaling"]	33	["Disgenet (Asthma)","CTD (Asthma)","CTD (Atherosclerosis)","Disgenet (Atherosclerosis)","CTD (Brain injuries)","CTD (Brain ischemia)","Disgenet (Brain ischemia)","Disgenet (Cerebrovascular disorder)","CTD (Cholangiocarcinoma)","Disgenet (Colitis)","Disgenet (Kidney disease)","Disgenet (Obstructive airway disease)"]
IL1B	17	["Asbestosis","Brain injuries","Brain ischemia","Cerebrovascular disorder","Cholelithiasis","Colitis","Obstructive airway disease","Colonic neoplasms","Congestive heart failure","Gastric ulcer","Seizures","Hyperalgesia"]	6	["Pertussis","Leishmaniasis","Chagas disease","Amoebiasis","Tuberculosis","Interleukin-4 and Interleukin-13 signaling"]	34	["CTD (Asbestosis)","Disgenet (Asbestosis)","Disgenet (Asthma)","CTD (Asthma)","CTD (Brain injuries)","CTD (Brain ischemia)","Disgenet (Brain ischemia)","Disgenet (Cerebrovascular disorder)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","Disgenet (Colitis)","Disgenet (Obstructive airway disease)"]
RELA	12	["Biliary cirrhosis","Brain injuries","Brain ischemia","Cholelithiasis","Colitis","Liver cirrhosis","Colonic neoplasms","Hepatic insufficiency","Hepatomegaly","Kidney failure","Biliary cholangitis","Urethral obstruction"]	9	["HIF-1 signaling pathway","Relaxin signaling pathway","Pertussis","Leishmaniasis","Chagas disease","Toxoplasmosis","Amoebiasis","Tuberculosis","Small cell lung cancer"]	16	["Disgenet (Biliary cirrhosis)","CTD (Brain injuries)","CTD (Brain ischemia)","Disgenet (Brain ischemia)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","Disgenet (Colitis)","CTD (Colitis)","CTD (Colonic neoplasms)","CTD (Hypertension)","CTD (Hepatic insufficiency)","CTD (Hepatomegaly)"]

Diseases Linked via Similar Genes

Cardiomyopathy Linked via 4 of 5 related genesNOS3, CAT, PTGS2, IL1B Stomach neoplasms Linked via 4 of 5 related genesNOS3, PTGS2, IL1B, RELA Arteriosclerosis Linked via 3 of 5 related genesNOS3, PTGS2, IL1B Behcet disease Linked via 3 of 5 related genesNOS3, CAT, IL1B Cystic fibrosis Linked via 3 of 5 related genesNOS3, PTGS2, IL1B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cardiomyopathy	4	["NOS3","CAT","PTGS2","IL1B"]
Stomach neoplasms	4	["NOS3","PTGS2","IL1B","RELA"]
Arteriosclerosis	3	["NOS3","PTGS2","IL1B"]
Behcet disease	3	["NOS3","CAT","IL1B"]
Cystic fibrosis	3	["NOS3","PTGS2","IL1B"]