HLA-DQB1 (major histocompatibility complex, class II, DQ beta 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3119
• Gene name: Major histocompatibility complex, class II, DQ beta 1
• Gene symbol: HLA-DQB1
• Synonyms (NCBI Gene): CELIAC1, HLA-DQB, IDDM1
• Chromosome: 6
• Chromosome location: 6p21.32
• Summary: HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides deriv

miRNA Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1048415	hsa-miR-1183	CLIP-seq
MIRT1048416	hsa-miR-3117-3p	CLIP-seq
MIRT1048417	hsa-miR-3169	CLIP-seq
MIRT1048418	hsa-miR-3170	CLIP-seq
MIRT1048419	hsa-miR-3189-3p	CLIP-seq
MIRT1048420	hsa-miR-342-5p	CLIP-seq
MIRT1048421	hsa-miR-380	CLIP-seq
MIRT1048422	hsa-miR-3924	CLIP-seq
MIRT1048423	hsa-miR-4252	CLIP-seq
MIRT1048424	hsa-miR-4495	CLIP-seq
MIRT1048425	hsa-miR-4651	CLIP-seq
MIRT1048426	hsa-miR-4664-5p	CLIP-seq
MIRT1048427	hsa-miR-4691-3p	CLIP-seq
MIRT1048428	hsa-miR-4695-3p	CLIP-seq
MIRT1048429	hsa-miR-4738-5p	CLIP-seq
MIRT1048430	hsa-miR-4759	CLIP-seq
MIRT1048431	hsa-miR-608	CLIP-seq
MIRT1048432	hsa-miR-944	CLIP-seq
MIRT1048415	hsa-miR-1183	CLIP-seq
MIRT1048416	hsa-miR-3117-3p	CLIP-seq
MIRT1048417	hsa-miR-3169	CLIP-seq
MIRT1048423	hsa-miR-4252	CLIP-seq
MIRT1048427	hsa-miR-4691-3p	CLIP-seq
MIRT1048430	hsa-miR-4759	CLIP-seq
MIRT1048415	hsa-miR-1183	CLIP-seq
MIRT1048416	hsa-miR-3117-3p	CLIP-seq
MIRT1048417	hsa-miR-3169	CLIP-seq
MIRT1048423	hsa-miR-4252	CLIP-seq
MIRT1048427	hsa-miR-4691-3p	CLIP-seq
MIRT1048428	hsa-miR-4695-3p	CLIP-seq
MIRT1048430	hsa-miR-4759	CLIP-seq

Transcription factors Show/Hide all (6)

Transcription factor	Regulation	Reference
CIITA	Unknown	11332992
CREB1	Unknown	1324879
DEK	Unknown	12823858
RFX5	Unknown	11258423;18723135
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423;18723135

Gene ontology (GO) Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0005515	Function	Protein binding	IPI	14769912, 17629515, 29997244, 33961781
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	2998758
GO:0006959	Process	Humoral immune response	IMP	17050030
GO:0010008	Component	Endosome membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	2998758
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	32341563
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IBA
GO:0032395	Function	MHC class II receptor activity	NAS	2998758
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	ISS	20356827
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IEA
GO:0042613	Component	MHC class II protein complex	ISS	20356827
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

Other IDs

• MIM: 604305
• HGNC: 4944
• e!Ensembl: ENSG00000179344

Protein

• UniProt ID: P01920
• Protein name: HLA class II histocompatibility antigen, DQ beta 1 chain (MHC class II antigen DQB1)
• Protein function: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T
• PDB: 1JK8 , 1S9V , 1UVQ , 2NNA , 4GG6 , 4OZF , 4OZG , 4OZH , 4OZI , 8VSP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00969	MHC_II_beta	45 → 118	Class II histocompatibility antigen, beta domain	Domain
  PF07654	C1-set	131 → 212	Immunoglobulin C1-set domain	Domain

• Sequence:

  MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVT
  RYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELR
  TTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLI
  RNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVL
  GLIFLGLGLIIHHRSQKGLLH

• Sequence length: 261

Pathways

KEGG Pathway	Reactome Pathway
Phagosome	Downstream TCR signaling
Cell adhesion molecules	Phosphorylation of CD3 and TCR zeta chains
Antigen processing and presentation	Translocation of ZAP-70 to Immunological synapse
Hematopoietic cell lineage	Generation of second messenger molecules
Th1 and Th2 cell differentiation	MHC class II antigen presentation
Th17 cell differentiation	PD-1 signaling
Intestinal immune network for IgA production	Interferon gamma signaling
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (193)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	34873335	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SICKLE CELL	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANGIOEDEMA	—	CTD	15784113	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTIPHOSPHOLIPID SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	10792356, 20860503, 21804548, 24388013, 29083406, 29785011, 30552067, 30578877, 30929738, 31036433, 31361310, 31619474, 31669095, 34103634, 34212547, 35104449, 36543808, 39024449, 39789286, 41213931	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	31669095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	37794016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	32534018	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS	—	GWAS catalog	28779025, 34594039, 39620209	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE PANCREATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE SYNDROME TYPE II, POLYGLANDULAR	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROIDITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	38182794	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN HEREDITARY CHOREA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN MUCOUS MEMBRANE PEMPHIGOID WITH OCULAR INVOLVEMENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BETA THALASSEMIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	19458352, 20639880, 21399635, 26394269, 34033851	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	27197191, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BOUILLAUDS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULLOUS PEMPHIGOID	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	23806156, 34011352, 37156394, 8710911	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED, 1H	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	31816047, 34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	35157032, 36929174	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	27197191, 33794208, 33893285, 34290314, 35157032, 36929174, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL INTRAEPITHELIAL NEOPLASIA GRADE 2/3	—	GWAS catalog	33794208	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	31036433, 31669095, 34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOREA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOREA, BENIGN FAMILIAL	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	37467720, 39620209	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	23770605	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE ASTHMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	30804561, 33106845, 35104449, 35308900, 36543808	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OSTEOMYELITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHURG-STRAUSS SYNDROME	—	GWAS catalog	31719529	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLD PAROXYSMAL HEMOGLOBINURIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON VARIABLE IMMUNODEFICIENCY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	25891430	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	21971053, 35285134, 38062574	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CREUTZFELDT-JAKOB DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CREUTZFELDT-JAKOB SYNDROME	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	17554300, 26192919, 26891255, 30500874, 32581322	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	39192244	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTL CARIES-SMOOTH SURF	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	39024449, 39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	26168013	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	39024449, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC POLYNEUROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	35841873, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENITIS	—	GWAS catalog	37965154	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENCEPHALOMYELITIS, ACUTE DISSEMINATED	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	27197191, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ACHALASIA	—	CTD, Disgenet CTD, Disgenet	24997987	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	27197191, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	32589924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EYE DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL APOLIPOPROTEIN B HYPOBETALIPOPROTEINEMIA	—	GWAS catalog	36168886	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	27197191, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS	—	GWAS catalog	37965154	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRITIS, ATROPHIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROPARESIS	—	GWAS catalog	37688361	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	36553520	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31985003	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	21841780, 31050781	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK MALIGNANT NEOPLASIA	—	GWAS catalog	27749845	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK SQUAMOUS CELL CARCINOMA	—	GWAS catalog	32276964	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING LOSS	—	GWAS catalog	35661827	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	36376295	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOGLOBINURIA, PAROXYSMAL	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	GWAS catalog	28698626, 33591409, 35470498	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	23242368, 27197191, 28921602, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	36273105	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	8725357	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	22493691, 27182965, 34594039, 37686882, 38368726, 39024449, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	22197929, 25305756, 34076728	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	17554300, 26192919, 26891255, 30500874, 32581322, 37377963, 37965154	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRAHEPATIC BILE DUCT CANCER	—	GWAS catalog	39024449, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	38102678	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATENT AUTOIMMUNE DIABETES IN ADULTS	—	GWAS catalog	30254083	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CANCER	—	GWAS catalog	39024449, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASM	—	GWAS catalog	34594039, 39024449, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 34594039, 37340002, 40783572	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	27197191, 33893285, 34290314, 34594039, 37340002, 40783572	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	27197191, 28604730, 32887889, 33893285, 34290314, 34594039, 37340002, 37601966, 37846649, 40783572	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	GWAS catalog	24925725	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC SYSTEM CANCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA	—	GWAS catalog	23349640, 34594039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	31619474	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	33893285	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	33106546	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	36273105	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	23472185, 37377963	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPIA, DEGENERATIVE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	26291516	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY	—	CTD, Disgenet CTD, Disgenet	20711174	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 1	—	Disgenet, Orphanet Disgenet, Orphanet	18706091	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY TYPE 2	—	Orphanet	18706091, 21345702	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY WITHOUT CATAPLEXY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	24204295	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	GWAS catalog	29903748, 30012571, 31263063, 37120605, 37547536, 38560502	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	27197191, 33893285, 34290314, 36273105, 37340002, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	29739929	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	32141793	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGOARTICULAR JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	23603761	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL CAVITY CANCER	—	GWAS catalog	27749845, 32276964, 34642315	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNGEAL NEOPLASMS	—	CTD	27749845	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	27749845, 34642315, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	27197191, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	25064009, 28892059, 31660654	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAROXYSMAL NOCTURNAL HEMOGLOBINURIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEMPHIGOID, BENIGN MUCOUS MEMBRANE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEMPHIGUS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	30230522	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEMPHIGUS VULGARIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	29857070, 30230522	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYARTICULAR JUVENILE IDIOPATHIC ARTHRITIS, RHEUMATOID FACTOR NEGATIVE	—	GWAS catalog	23603761	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMYOSITIS	—	GWAS catalog	36580032	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	19458352, 20639880, 21399635, 22936693, 22961000, 26394269, 34033851	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY HYPERTHYROIDISM	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	32887889, 33398198, 37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	27197191, 32887889, 33398198, 33893285, 34290314, 37340002, 37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	38757301, 39789286, 39885523	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	30552173	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM NEOPLASM	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	17554300, 18668548, 18794853, 20453841, 23918589, 26272072, 28706201, 37377963, 37947095, 38368726, 39620209	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	34594039, 40075078	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	26198764, 28540026, 30285260	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	20383147	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	23603763, 36828809, 38490347	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	22036096, 24388013, 30013184, 31361310, 34594039, 39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	24097067	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	34594039, 37340002, 39024449, 40783572	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	27197191, 32887889, 33893285, 34290314, 37340002, 39366959	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH DISEASES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	23603761	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	21408207, 26316170, 33272962, 34076728, 34594039, 36762574, 38724181	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	20383147, 21750679, 21779181	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROTOXIC PERIODIC PARALYSIS	—	GWAS catalog	31050781	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONGUE CANCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONGUE NEOPLASM	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONSIL CANCER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	37151119	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	17632545, 30254083, 30659077, 31152121, 33179336, 34594039, 38453145, 39024449, 39556808, 40465716, 40569436	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES NEPHROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	17632545, 27189021, 30054458, 30254083, 30659077, 31152121, 32541925, 33893285, 34594039, 34737425, 38062574, 38453145, 39024449, 40465716, 40569436	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	24837172, 26192919, 39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	27749845	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	16502481	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEOMENINGOENCEPHALITIC SYNDROME	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HLA-DQA1 76 shared diseasesAplastic anemia, Dilated cardiomyopathy, Antiphospholipid syndrome, Arthritis, Psoriatic arthritis, Rhinitis, Autoimmune hepatitis, Autoimmune polyendocrine syndrome, Autoimmune thyroid disease, Benign hereditary chorea, Biliary cirrhosis, Bouillaud’s disease +64 more 31 shared pathwaysPhagosome, Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, Intestinal immune network for IgA production, Type I diabetes mellitus, Leishmaniasis, Toxoplasmosis, Staphylococcus aureus infection, Tuberculosis +19 more 94 shared evidence sourcesDisgenet (Ankylosing spondylitis), Disgenet (Antiphospholipid syndrome), Disgenet (Aplastic anemia), Disgenet (Arthritis), Disgenet (Asthma), CTD (Asthma), Disgenet (Rhinitis), GWAS catalog (Autoimmune hepatitis), Disgenet (Autoimmune polyendocrine syndrome), Disgenet (Autoimmune thyroid disease), Disgenet (Systemic lupus erythematosus), GWAS catalog (Basal cell carcinoma) +82 more Related via 76 shared diseases including Aplastic anemia, Dilated cardiomyopathy — evidence mostly Disgenet. HLA-DRB1 57 shared diseasesAngioedema, Antiphospholipid syndrome, Autoimmune hepatitis, Autoimmune polyendocrine syndrome, Autoimmune thyroid disease, Behcet disease, Benign hereditary chorea, Benign mucous membrane pemphigoid with ocular involvement, Bouillaud’s disease, Bullous pemphigoid, Cancer, Celiac disease +45 more 31 shared pathwaysPhagosome, Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, Intestinal immune network for IgA production, Type I diabetes mellitus, Leishmaniasis, Toxoplasmosis, Staphylococcus aureus infection, Tuberculosis +19 more 80 shared evidence sourcesCTD (Angioedema), Disgenet (Ankylosing spondylitis), Disgenet (Antiphospholipid syndrome), Disgenet (Asthma), CTD (Asthma), Disgenet (Autoimmune hepatitis), Disgenet (Autoimmune polyendocrine syndrome), Disgenet (Autoimmune thyroid disease), Disgenet (Systemic lupus erythematosus), GWAS catalog (Basal cell carcinoma), Disgenet (Behcet disease), Disgenet (Benign hereditary chorea) +68 more Related via 57 shared diseases including Angioedema, Antiphospholipid syndrome — evidence mostly Disgenet. HLA-DRA 32 shared diseasesAntiphospholipid syndrome, Autoimmune thyroid disease, Biliary cirrhosis, Biliary tract cancer, Bullous pemphigoid, Cancer, Celiac disease, Cervical cancer, Interstitial cystitis, Hodgkin lymphoma, Endometrial cancer, Esophageal cancer +20 more 31 shared pathwaysPhagosome, Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, Intestinal immune network for IgA production, Type I diabetes mellitus, Leishmaniasis, Toxoplasmosis, Staphylococcus aureus infection, Tuberculosis +19 more 37 shared evidence sourcesDisgenet (Asthma), Disgenet (Autoimmune thyroid disease), GWAS catalog (Basal cell carcinoma), GWAS catalog (Biliary cirrhosis), GWAS catalog (Biliary tract cancer), GWAS catalog (Bullous pemphigoid), GWAS catalog (Cancer), GWAS catalog (Celiac disease), GWAS catalog (Cervical cancer), GWAS catalog (Interstitial cystitis), GWAS catalog (Hodgkin lymphoma), GWAS catalog (Endometrial cancer) +25 more Related via 32 shared diseases including Antiphospholipid syndrome, Autoimmune thyroid disease — evidence mostly GWAS catalog. HLA-DPB1 16 shared diseasesAngioedema, Autoimmune hepatitis, Biliary cirrhosis, Celiac disease, Cervical cancer, Liver cirrhosis, Hyperthyroidism, Gastroparesis, Myasthenia gravis, Liver neoplasms, Narcolepsy, Biliary cholangitis +4 more 31 shared pathwaysPhagosome, Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, Intestinal immune network for IgA production, Type I diabetes mellitus, Leishmaniasis, Toxoplasmosis, Staphylococcus aureus infection, Tuberculosis +19 more 24 shared evidence sourcesCTD (Angioedema), Disgenet (Asthma), CTD (Asthma), Disgenet (Autoimmune hepatitis), GWAS catalog (Biliary cirrhosis), GWAS catalog (Celiac disease), CTD (Celiac disease), Disgenet (Celiac disease), GWAS catalog (Cervical cancer), GWAS catalog (Liver cirrhosis), Disgenet (Diabetes mellitus type 1), GWAS catalog (Gastroparesis) +12 more Related via 31 shared pathways including Phagosome, Cell adhesion molecules — evidence mostly GWAS catalog. HLA-DRB5 13 shared diseasesBullous pemphigoid, Cancer, Cervical cancer, Dental caries, Acute disseminated encephalomyelitis, Estrogen-receptor negative breast cancer, Hyperthyroidism, Henoch schoenlein purpura, Hypersensitivity, Nephrotic syndrome, Myasthenia gravis, Ovarian serous carcinoma +1 more 31 shared pathwaysPhagosome, Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, Intestinal immune network for IgA production, Type I diabetes mellitus, Leishmaniasis, Toxoplasmosis, Staphylococcus aureus infection, Tuberculosis +19 more 12 shared evidence sourcesGWAS catalog (Bullous pemphigoid), GWAS catalog (Cancer), GWAS catalog (Cervical cancer), GWAS catalog (Dental caries), Disgenet (Acute disseminated encephalomyelitis), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Henoch schoenlein purpura), CTD (Hypersensitivity), GWAS catalog (Hyperthyroidism), GWAS catalog (Nephrotic syndrome), GWAS catalog (Ovarian serous carcinoma), GWAS catalog (Sarcoidosis) Related via 31 shared pathways including Phagosome, Cell adhesion molecules — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HLA-DQA1	76	["Aplastic anemia","Dilated cardiomyopathy","Antiphospholipid syndrome","Arthritis","Psoriatic arthritis","Rhinitis","Autoimmune hepatitis","Autoimmune polyendocrine syndrome","Autoimmune thyroid disease","Benign hereditary chorea","Biliary cirrhosis","Bouillaud\u2019s disease"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	94	["Disgenet (Ankylosing spondylitis)","Disgenet (Antiphospholipid syndrome)","Disgenet (Aplastic anemia)","Disgenet (Arthritis)","Disgenet (Asthma)","CTD (Asthma)","Disgenet (Rhinitis)","GWAS catalog (Autoimmune hepatitis)","Disgenet (Autoimmune polyendocrine syndrome)","Disgenet (Autoimmune thyroid disease)","Disgenet (Systemic lupus erythematosus)","GWAS catalog (Basal cell carcinoma)"]
HLA-DRB1	57	["Angioedema","Antiphospholipid syndrome","Autoimmune hepatitis","Autoimmune polyendocrine syndrome","Autoimmune thyroid disease","Behcet disease","Benign hereditary chorea","Benign mucous membrane pemphigoid with ocular involvement","Bouillaud\u2019s disease","Bullous pemphigoid","Cancer","Celiac disease"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	80	["CTD (Angioedema)","Disgenet (Ankylosing spondylitis)","Disgenet (Antiphospholipid syndrome)","Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","Disgenet (Autoimmune polyendocrine syndrome)","Disgenet (Autoimmune thyroid disease)","Disgenet (Systemic lupus erythematosus)","GWAS catalog (Basal cell carcinoma)","Disgenet (Behcet disease)","Disgenet (Benign hereditary chorea)"]
HLA-DRA	32	["Antiphospholipid syndrome","Autoimmune thyroid disease","Biliary cirrhosis","Biliary tract cancer","Bullous pemphigoid","Cancer","Celiac disease","Cervical cancer","Interstitial cystitis","Hodgkin lymphoma","Endometrial cancer","Esophageal cancer"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	37	["Disgenet (Asthma)","Disgenet (Autoimmune thyroid disease)","GWAS catalog (Basal cell carcinoma)","GWAS catalog (Biliary cirrhosis)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Bullous pemphigoid)","GWAS catalog (Cancer)","GWAS catalog (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Interstitial cystitis)","GWAS catalog (Hodgkin lymphoma)","GWAS catalog (Endometrial cancer)"]
HLA-DPB1	16	["Angioedema","Autoimmune hepatitis","Biliary cirrhosis","Celiac disease","Cervical cancer","Liver cirrhosis","Hyperthyroidism","Gastroparesis","Myasthenia gravis","Liver neoplasms","Narcolepsy","Biliary cholangitis"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	24	["CTD (Angioedema)","Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","GWAS catalog (Biliary cirrhosis)","GWAS catalog (Celiac disease)","CTD (Celiac disease)","Disgenet (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Liver cirrhosis)","Disgenet (Diabetes mellitus type 1)","GWAS catalog (Gastroparesis)"]
HLA-DRB5	13	["Bullous pemphigoid","Cancer","Cervical cancer","Dental caries","Acute disseminated encephalomyelitis","Estrogen-receptor negative breast cancer","Hyperthyroidism","Henoch schoenlein purpura","Hypersensitivity","Nephrotic syndrome","Myasthenia gravis","Ovarian serous carcinoma"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	12	["GWAS catalog (Bullous pemphigoid)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Dental caries)","Disgenet (Acute disseminated encephalomyelitis)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Henoch schoenlein purpura)","CTD (Hypersensitivity)","GWAS catalog (Hyperthyroidism)","GWAS catalog (Nephrotic syndrome)","GWAS catalog (Ovarian serous carcinoma)","GWAS catalog (Sarcoidosis)"]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 4 of 5 related genesHLA-DQA1, HLA-DRB1, HLA-DRA, HLA-DRB5 Azoospermia Linked via 3 of 5 related genesHLA-DQA1, HLA-DRB1, HLA-DRA Central nervous system non-hodgkin lymphoma Linked via 3 of 5 related genesHLA-DQA1, HLA-DRB1, HLA-DRB5 Diffuse cutaneous systemic sclerosis Linked via 3 of 5 related genesHLA-DQA1, HLA-DRB1, HLA-DPB1 Nonalcoholic fatty liver disease Linked via 3 of 5 related genesHLA-DQA1, HLA-DRB1, HLA-DRB5

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	4	["HLA-DQA1","HLA-DRB1","HLA-DRA","HLA-DRB5"]
Azoospermia	3	["HLA-DQA1","HLA-DRB1","HLA-DRA"]
Central nervous system non-hodgkin lymphoma	3	["HLA-DQA1","HLA-DRB1","HLA-DRB5"]
Diffuse cutaneous systemic sclerosis	3	["HLA-DQA1","HLA-DRB1","HLA-DPB1"]
Nonalcoholic fatty liver disease	3	["HLA-DQA1","HLA-DRB1","HLA-DRB5"]