Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3115
Gene name	Major histocompatibility complex, class II, DP beta 1
Gene symbol	HLA-DPB1
Synonyms (NCBI Gene)	DPB1HLA-DPHLA-DP1BHLA-DPB
Chromosome	6
Chromosome location	6p21.32
Summary	HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides deri

61 Show/Hide all (61)

miRTarBase ID	miRNA	Experiments
MIRT1048385	hsa-miR-103a	CLIP-seq
MIRT1048386	hsa-miR-107	CLIP-seq
MIRT1048387	hsa-miR-1286	CLIP-seq
MIRT1048388	hsa-miR-15a	CLIP-seq
MIRT1048389	hsa-miR-15b	CLIP-seq
MIRT1048390	hsa-miR-16	CLIP-seq
MIRT1048391	hsa-miR-195	CLIP-seq
MIRT1048392	hsa-miR-214	CLIP-seq
MIRT1048393	hsa-miR-3127-5p	CLIP-seq
MIRT1048394	hsa-miR-3185	CLIP-seq
MIRT1048395	hsa-miR-3612	CLIP-seq
MIRT1048396	hsa-miR-3619-5p	CLIP-seq
MIRT1048397	hsa-miR-3672	CLIP-seq
MIRT1048398	hsa-miR-3919	CLIP-seq
MIRT1048399	hsa-miR-3944-5p	CLIP-seq
MIRT1048400	hsa-miR-424	CLIP-seq
MIRT1048401	hsa-miR-4270	CLIP-seq
MIRT1048402	hsa-miR-4291	CLIP-seq
MIRT1048403	hsa-miR-4293	CLIP-seq
MIRT1048404	hsa-miR-4310	CLIP-seq
MIRT1048405	hsa-miR-4441	CLIP-seq
MIRT1048406	hsa-miR-4443	CLIP-seq
MIRT1048407	hsa-miR-4722-5p	CLIP-seq
MIRT1048408	hsa-miR-4756-3p	CLIP-seq
MIRT1048409	hsa-miR-4768-3p	CLIP-seq
MIRT1048410	hsa-miR-497	CLIP-seq
MIRT1048411	hsa-miR-548u	CLIP-seq
MIRT1048412	hsa-miR-650	CLIP-seq
MIRT1048413	hsa-miR-761	CLIP-seq
MIRT1048414	hsa-miR-922	CLIP-seq
MIRT2011006	hsa-miR-1200	CLIP-seq
MIRT2011007	hsa-miR-1206	CLIP-seq
MIRT2011008	hsa-miR-18a	CLIP-seq
MIRT2011009	hsa-miR-18b	CLIP-seq
MIRT2011010	hsa-miR-1911	CLIP-seq
MIRT2011011	hsa-miR-3605-5p	CLIP-seq
MIRT2011012	hsa-miR-3907	CLIP-seq
MIRT1048403	hsa-miR-4293	CLIP-seq
MIRT2011013	hsa-miR-4324	CLIP-seq
MIRT2011014	hsa-miR-4709-3p	CLIP-seq
MIRT2011015	hsa-miR-4729	CLIP-seq
MIRT2011016	hsa-miR-4735-3p	CLIP-seq
MIRT2011017	hsa-miR-4778-3p	CLIP-seq
MIRT2011018	hsa-miR-544b	CLIP-seq
MIRT2011019	hsa-miR-579	CLIP-seq
MIRT2011020	hsa-miR-617	CLIP-seq
MIRT2011008	hsa-miR-18a	CLIP-seq
MIRT2011009	hsa-miR-18b	CLIP-seq
MIRT1048395	hsa-miR-3612	CLIP-seq
MIRT1048397	hsa-miR-3672	CLIP-seq
MIRT2011012	hsa-miR-3907	CLIP-seq
MIRT2243279	hsa-miR-3910	CLIP-seq
MIRT1048406	hsa-miR-4443	CLIP-seq
MIRT2011014	hsa-miR-4709-3p	CLIP-seq
MIRT2011016	hsa-miR-4735-3p	CLIP-seq
MIRT1048412	hsa-miR-650	CLIP-seq
MIRT2389013	hsa-miR-326	CLIP-seq
MIRT2389014	hsa-miR-330-5p	CLIP-seq
MIRT2389015	hsa-miR-4777-3p	CLIP-seq
MIRT2389016	hsa-miR-875-5p	CLIP-seq
MIRT2682321	hsa-miR-520f	CLIP-seq

Transcription factor	Regulation	Reference
CIITA	Unknown	11889043
RFX1	Unknown	11889043
RFX5	Unknown	11258423
RFXANK	Unknown	11258423
RFXAP	Unknown	11258423

44 Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002504	Process	Antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0009986	Component	Cell surface	IMP	20356827
GO:0010008	Component	Endosome membrane	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	IEA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IDA	32341563
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IMP	20356827
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030658	Component	Transport vesicle membrane	TAS
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031902	Component	Late endosome membrane	IBA
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032729	Process	Positive regulation of type II interferon production	IMP	20356827
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	20356827
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042605	Function	Peptide antigen binding	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042613	Component	MHC class II protein complex	IDA	20356827
GO:0042613	Component	MHC class II protein complex	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	32341563
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IMP	20356827
GO:0098553	Component	Lumenal side of endoplasmic reticulum membrane	TAS

MIM	HGNC	e!Ensembl
142858	4940	ENSG00000223865

P04440

Protein name

HLA class II histocompatibility antigen, DP beta 1 chain (HLA class II histocompatibility antigen, DP(W4) beta chain) (MHC class II antigen DPB1)

Protein function

Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. T

PDB

3LQZ , 4P4K , 4P4R , 4P57 , 4P5K , 4P5M , 7T2A , 7T2B , 7T2C , 7T2D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00969	MHC_II_beta	42 → 114	Class II histocompatibility antigen, beta domain	Domain
PF07654	C1-set	126 → 207	Immunoglobulin C1-set domain	Domain

Sequence

MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN
REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA

Sequence length

258

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Phagosome	Downstream TCR signaling
Cell adhesion molecules	Phosphorylation of CD3 and TCR zeta chains
Antigen processing and presentation	Translocation of ZAP-70 to Immunological synapse
Hematopoietic cell lineage	Generation of second messenger molecules
Th1 and Th2 cell differentiation	MHC class II antigen presentation
Th17 cell differentiation	PD-1 signaling
Intestinal immune network for IgA production	Interferon gamma signaling
Type I diabetes mellitus
Leishmaniasis
Toxoplasmosis
Staphylococcus aureus infection
Tuberculosis
Influenza A
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (53)
ANGIOEDEMA	—	CTD	15784113	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTI-BASEMENT MEMBRANE GLOMERULONEPHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTI-NEUTROPHIL ANTIBODY ASSOCIATED VASCULITIS	—	GWAS catalog	28029757, 36530128	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTI-TOPOISOMERASE-I-ANTIBODY-POSITIVE SYSTEMIC SCLERODERMA	—	GWAS catalog	38296975	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	17956852, 22286218	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	16792590, 17956852, 21814517, 29083406, 31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, ASPIRIN-INDUCED	—	CTD	16502481	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BERYLLIOSIS	—	CTD	11551429, 14662898, 15273960, 17927685, 17956852, 8105536	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Beryllium disease, chronic, susceptibility to	risk factor	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	28425483	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	17956852, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BERYLLIOSIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BERYLLIUM DISEASE	—	Orphanet	22972925	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	37601966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, IRRITANT	—	CTD, Disgenet CTD, Disgenet	27258892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOMYOSITIS	—	GWAS catalog	27153935	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE SCLERODERMA	—	GWAS catalog	38296975	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	17956852	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROPARESIS	—	GWAS catalog	37688361	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	39406924	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAFT-VS-HOST DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRANULOMATOSIS WITH POLYANGIITIS	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	23740775	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	34594039, 38368726, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	38296975	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASM	—	GWAS catalog	37601966	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	27501781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	14975599	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	17956852	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	CTD, Disgenet CTD, Disgenet	17956852	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	30664745, 40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	30664745, 34450027, 40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	30664745, 34450027, 37247657, 40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	28425483	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	39885523	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ARTERIAL HYPERTENSION	—	GWAS catalog	30527956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	38368726	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	CTD, Disgenet CTD, Disgenet	14508706, 17956852, 8909942	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	28076899	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	33272962	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	21779181, 38296975	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	16502481	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	23817570	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HLA-DPA1	12	["Systemic scleroderma","Anti-neutrophil antibody associated vasculitis","Celiac disease","Cervical cancer","Liver cirrhosis","Irritant dermatitis","Dermatomyositis","Diffuse cutaneous systemic sclerosis","Granulomatosis with polyangiitis","Pulmonary arterial hypertension","Interstitial lung disease","Systemic sclerosis"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	15	["GWAS catalog (Systemic scleroderma)","GWAS catalog (Anti-neutrophil antibody associated vasculitis)","Disgenet (Asthma)","GWAS catalog (Celiac disease)","GWAS catalog (Cervical cancer)","CTD (Irritant dermatitis)","Disgenet (Irritant dermatitis)","GWAS catalog (Dermatomyositis)","Disgenet (Diabetes mellitus type 1)","GWAS catalog (Diffuse cutaneous systemic sclerosis)","Disgenet (Granulomatosis with polyangiitis)","Orphanet (Granulomatosis with polyangiitis)"]
HLA-DRA	9	["Biliary cirrhosis","Celiac disease","Cervical cancer","Dermatomyositis","Hyperthyroidism","Biliary cholangitis","Sarcoidosis","Sjogren syndrome","Systemic sclerosis"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	11	["Disgenet (Asthma)","GWAS catalog (Biliary cirrhosis)","GWAS catalog (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Dermatomyositis)","GWAS catalog (Hyperthyroidism)","Disgenet (Multiple sclerosis)","CTD (Multiple sclerosis)","GWAS catalog (Biliary cholangitis)","GWAS catalog (Sjogren syndrome)","GWAS catalog (Systemic sclerosis)"]
HLA-DQB1	16	["Angioedema","Autoimmune hepatitis","Biliary cirrhosis","Celiac disease","Cervical cancer","Liver cirrhosis","Hyperthyroidism","Gastroparesis","Myasthenia gravis","Liver neoplasms","Narcolepsy","Biliary cholangitis"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	24	["CTD (Angioedema)","Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","GWAS catalog (Biliary cirrhosis)","GWAS catalog (Celiac disease)","CTD (Celiac disease)","Disgenet (Celiac disease)","GWAS catalog (Cervical cancer)","GWAS catalog (Liver cirrhosis)","Disgenet (Diabetes mellitus type 1)","GWAS catalog (Gastroparesis)"]
HLA-DRB1	15	["Angioedema","Anti-glomerular basement membrane disease","Autoimmune hepatitis","Berylliosis","Celiac disease","Cervical cancer","Liver cirrhosis","Diffuse cutaneous systemic sclerosis","Hyperthyroidism","Myasthenia gravis","Narcolepsy","Sarcoidosis"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	23	["CTD (Angioedema)","Disgenet (Anti-glomerular basement membrane disease)","CTD (Rheumatoid arthritis)","Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","CTD (Berylliosis)","GWAS catalog (Celiac disease)","Disgenet (Celiac disease)","GWAS catalog (Cervical cancer)","Disgenet (Diabetes mellitus type 1)","Disgenet (Endometriosis)"]
HLA-DQA1	17	["Anti-neutrophil antibody associated vasculitis","Autoimmune hepatitis","Biliary cirrhosis","Celiac disease","Cervical cancer","Liver cirrhosis","Diffuse cutaneous systemic sclerosis","Hyperthyroidism","Gastroparesis","Myasthenia gravis","Liver neoplasms","Narcolepsy"]	31	["Phagosome","Cell adhesion molecules","Antigen processing and presentation","Hematopoietic cell lineage","Th1 and Th2 cell differentiation","Th17 cell differentiation","Intestinal immune network for IgA production","Type I diabetes mellitus","Leishmaniasis","Toxoplasmosis","Staphylococcus aureus infection","Tuberculosis"]	17	["GWAS catalog (Anti-neutrophil antibody associated vasculitis)","Disgenet (Asthma)","CTD (Asthma)","GWAS catalog (Celiac disease)","CTD (Celiac disease)","Disgenet (Celiac disease)","GWAS catalog (Cervical cancer)","Disgenet (Diabetes mellitus type 1)","GWAS catalog (Gastroparesis)","GWAS catalog (Hyperthyroidism)","GWAS catalog (Liver neoplasms)","Disgenet (Multiple sclerosis)"]

HLA-DPB1 (major histocompatibility complex, class II, DP beta 1)

Bookmark This Gene