CCL2 (C-C motif chemokine ligand 2)

Gene

• Entrez ID: 6347
• Gene name: C-C motif chemokine ligand 2
• Gene symbol: CCL2
• Synonyms (NCBI Gene): GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the ar

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay	19404929
MIRT021047	hsa-miR-155-5p	Proteomics	18668040
MIRT024058	hsa-miR-1-3p	Microarray	18668037
MIRT030277	hsa-miR-26b-5p	Microarray	19088304
MIRT030558	hsa-miR-24-3p	Microarray	19748357
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24122720
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24122720
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24122720
MIRT731131	hsa-miR-495-3p	ELISA, qRT-PCR, Luciferase reporter assay, Western blot	25466836
MIRT731131	hsa-miR-495-3p	ELISA, qRT-PCR, Luciferase reporter assay, Western blot	25466836
MIRT732272	hsa-miR-518a-5p	ELISA, qRT-PCR, Western blot	28341837
MIRT732272	hsa-miR-518a-5p	ELISA, qRT-PCR, Western blot	28341837
MIRT024058	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT024058	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT732726	hsa-miR-550a-3-5p	Immunohistochemistry (IHC), Microarray, qRT-PCR, Western blotting	32493454
MIRT735937	hsa-miR-493-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33332775
MIRT755529	hsa-miR-149-3p	qRT-PCR	36250208
MIRT756186	hsa-miR-146a-5p	Western blotting, qRT-PCR	36409752
MIRT871036	hsa-miR-1323	CLIP-seq
MIRT871037	hsa-miR-3667-5p	CLIP-seq
MIRT871038	hsa-miR-371b-5p	CLIP-seq
MIRT871039	hsa-miR-527	CLIP-seq
MIRT871040	hsa-miR-548o	CLIP-seq
MIRT2427164	hsa-miR-3143	CLIP-seq
MIRT2427165	hsa-miR-543	CLIP-seq
MIRT2427166	hsa-miR-664	CLIP-seq
MIRT2498638	hsa-miR-124	CLIP-seq
MIRT2498639	hsa-miR-23a	CLIP-seq
MIRT2498640	hsa-miR-23b	CLIP-seq
MIRT2498641	hsa-miR-23c	CLIP-seq
MIRT2498642	hsa-miR-3714	CLIP-seq
MIRT2498643	hsa-miR-3910	CLIP-seq
MIRT2498644	hsa-miR-409-3p	CLIP-seq
MIRT2498645	hsa-miR-506	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APEX1	Activation	17045925
ATF4	Unknown	16931790
CEBPA	Activation	24429361
HDAC2	Unknown	22679019
IRF3	Unknown	20483755
JUN	Activation	18443042
NFAT5	Repression	22619484
NFIC	Activation	16206198
NFKB1	Activation	10530453;11512674;12488502;12647268;16206198;16764699;20200316;9388261
NFKB1	Unknown	10744656;11006087;11949945;12218154;14631383;15950427;16040075;16818736;8617886
NR1I2	Repression	22248096
PREB	Unknown	19426980
REL	Activation	10469356;9388261
RELA	Activation	10530453;12488502;12647268;16206198;16764699;17452470;20200316;9388261
RELA	Unknown	10744656;11006087;11949945;12218154;14631383;15950427;16040075;16730843;16818736;8617886
SP1	Activation	10644332
SP1	Unknown	12488502
SPI1	Activation	24429361
STAT1	Unknown	12388243;17167270
STAT2	Unknown	17167270
STAT3	Activation	24429361
XBP1	Unknown	16931790

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	TAS	18334747
GO:0002548	Process	Monocyte chemotaxis	IDA	12207323
GO:0004672	Function	Protein kinase activity	TAS	9973507
GO:0005102	Function	Signaling receptor binding	TAS	10542238
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	26095031, 27044744, 28381538, 32296183
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10942204
GO:0006468	Process	Protein phosphorylation	TAS	9670957
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10623817
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	TAS	9548499
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007155	Process	Cell adhesion	TAS	10198043
GO:0007165	Process	Signal transduction	NAS	10770925
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9548499
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10542238
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	10770925
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	9670957
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	9792674
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10623817
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0009617	Process	Response to bacterium	NAS	16034137
GO:0009887	Process	Animal organ morphogenesis	TAS	9364936
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010759	Process	Positive regulation of macrophage chemotaxis	ISS
GO:0019079	Process	Viral genome replication	TAS	10985244
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	12207323
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019725	Process	Cellular homeostasis	TAS	18334747
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031727	Function	CCR2 chemokine receptor binding	ISS
GO:0031727	Function	CCR2 chemokine receptor binding	TAS	18021937
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IDA	12753088
GO:0035684	Process	Helper T cell extravasation	ISS
GO:0038148	Process	Chemokine (C-C motif) ligand 2 signaling pathway	ISS
GO:0042056	Function	Chemoattractant activity	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	12753088
GO:0043615	Process	Astrocyte cell migration	IDA	12271471
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEP	9407497
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048246	Process	Macrophage chemotaxis	IDA	12207323
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	9182688, 10587439, 35570218
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	9792674
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071346	Process	Cellular response to type II interferon	IEP	9407497
GO:0071346	Process	Cellular response to type II interferon	ISS
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS
GO:0090280	Process	Positive regulation of calcium ion import	IDA	10925302
GO:1900451	Process	Positive regulation of glutamate receptor signaling pathway	ISS
GO:1905563	Process	Negative regulation of vascular endothelial cell proliferation	IMP	25466836
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IMP	25466836
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	25466836
GO:2000427	Process	Positive regulation of apoptotic cell clearance	ISS
GO:2000502	Process	Negative regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 158105
• HGNC: 10618
• e!Ensembl: ENSG00000108691

Protein

• UniProt ID: P13500
• Protein name: C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
• Protein function: Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:
• PDB: 1DOK, 1DOL, 1DOM, 1DON, 1ML0, 2BDN, 2NZ1, 3IFD, 4DN4, 4R8I, 4ZK9, 7SO0, 7XA3, 8FJ0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level) (PubMed:23765988). Expressed in monocytes (PubMed:2513477). {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2513477}.
• Sequence:

  MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
  KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

• Sequence length: 99

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANTERIOR UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCL2-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPRESSION OF SPINAL CORD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL ARTERITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART VALVE PROLAPSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HENOCH-SCHOENLEIN PURPURA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPOPROTEINEMIAS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROXALURIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEISHMANIASIS, CUTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLEURAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spina bifida, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to HIV infection	protective	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abetalipoproteinemia	Abetalipoproteinemia	BEFREE	24112389		★☆☆☆☆ Found in Text Mining only
Acrania	Acrania	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	24092547		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	14637261, 29874658, 30551392		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21298741		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25860293		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	15880317, 16636603, 17940904, 18837094, 19844201, 29511434, 31054479		★☆☆☆☆ Found in Text Mining only
Acute recurrent pancreatitis	Pancreatitis	BEFREE	19844201		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	28765037		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15900302, 17390111, 21187454, 21356356, 25915587, 26146082, 28946699, 8592656		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11156403, 23349788, 28212753, 29722145, 31243299		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	8701989		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26146082		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	16497622		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	22861370		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21298741		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30374624		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27980102		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21943176, 29474906, 31729527		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10987310		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	11603815, 17065190		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	17652758, 18172114, 20206286, 20361964, 21126357, 21386905, 22357958, 23185481, 23946637, 24142887, 24664727, 26446211, 26476672, 27316788, 27812755, 28095095, 28438165, 28546942, 28765149, 29664944, 30048978, 30160348, 31288713		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	18172114		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	28231622, 28427824, 28458180		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	23454776		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	16479072		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	16479072		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	16324872, 17720292, 26163174		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17284607, 18637012, 21755121, 22543850, 23380586, 40348203	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22272623, 24359497, 29352259, 30092003, 30336198, 32634865, 34624603, 37848007, 38167125	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15488313		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	30981714		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	14597108		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20544912, 21906274, 22472631, 22685564, 23752092, 28651542, 29029824, 31175169		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	21906274, 28798369, 29592817	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	22685564, 30572951, 32515902	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophy, monomelic	Monomelic Amyotrophy	BEFREE	27956076		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10381273, 31220553		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	26625205, 28730964		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	21442636		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	21442636, 21859849	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	33776989	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22033263, 29697532, 31641850		★☆☆☆☆ Found in Text Mining only
Anencephaly	Anencephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	19639050	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	22420243	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	12871422	Inhibit	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	22664781	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	25424368	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	12775581		★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	16129702		★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	30429240		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	23928854, 27921117		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27354473, 29205349		★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	LHGDN	16280979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior uveitis	Uveitis	BEFREE	19628738, 30288998		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anthracosis	Anthracosis	BEFREE	16524739		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	11937582		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	11937582, 25785264	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	21996300		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	16308497, 17321344, 19008128, 25033895, 8494046	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	16308497, 21996300, 22912384, 28288890, 28545777, 28882868, 29262630, 29388563, 30991034, 31201975, 31651935, 31658493		★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	28024939		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	31285364		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	30918467	Associate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	16308497		★☆☆☆☆ Found in Text Mining only
Arterial Diseases, Common Carotid	Moyamoya disease	CTD_human_DG	18022660		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10079097, 11319201, 11591377, 11755917, 11838000, 12548076, 13678532, 14620921, 14739122, 15189499, 15466648, 15578196, 16116069, 16246346, 16356504, 16445900, 16741188, 16794480, 16799229, 16825596, 17045925, 17180354, 17255531, 17456576, 18230355, 18651322, 18669888, 18802016, 18977211, 19148342, 19167353, 19450143, 19506371, 19781803, 19858416, 19958400, 20195282, 20413732, 20467793, 20573518, 21663591, 21756880, 21868018, 21975431, 22282402, 22293444, 23402987, 23564080, 23564081, 24098801, 24862889, 25655256, 25786118, 26354107, 27592629, 28041913, 28189525, 28246398, 28272702, 28282403, 28536301, 28566450, 28646427, 28672844, 28946319, 28957799, 29098933, 29154780, 29251559, 29378168, 29596634, 29795012, 29864522, 29874658, 29990859, 30006321, 30049285, 30426302, 30918133, 30946765, 31152776, 31203904, 31388753, 31476962, 31737059, 31739217, 31773386, 31797473, 31811853, 8580375, 8872602, 9366570		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12960349, 1522232, 15611878, 1624809, 19788897, 20012054, 21607290, 22037282, 24696480, 26069140, 28192374, 29145862, 30397205, 8403545, 9207007		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	15611878		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22035391	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22687048, 40534874	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	32154187	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10086850, 12368213, 30181004, 31864394	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	23480385	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10494903, 16464743, 16901957, 22131127, 7521808	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11178128, 11352233, 12588667, 15077296, 1522232, 15248214, 16740681, 17530707, 18205922, 18576354, 19404929, 19565503, 19625220, 21834066, 23784528, 26223686, 26514518, 28619088, 28708839, 30079994, 30897288, 31729947, 32365786, 32508836, 33508012, 33879239, 33977746, 34195267, 36439145, 38043198, 38459704, 7545093	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24023637, 25918734, 32497778	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	30910989		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	1624809, 8403545		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11544456, 14968124, 15005768, 16801146, 18615095, 23204071, 23454776, 24112389, 25765592, 28168862, 28275176, 30828084, 31664304, 31676759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16792687, 18492738, 23454776, 24736642, 24931417, 26207385, 31391224, 31676759, 33626956, 34525985, 37455894	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	19373627		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	21999750, 24641287	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	40696647	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10644332, 11160334, 11949822, 1937574, 25550546, 7517920, 9558097		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1937574	Associate	★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 2	Atelosteogenesis	Pubtator	34425224	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10079097, 11319201, 11591377, 11755917, 11838000, 12548076, 13678532, 14620921, 14739122, 15189499, 15466648, 16116069, 16246346, 16356504, 16445900, 16741188, 16794480, 16799229, 16825596, 17045925, 17180354, 17255531, 17456576, 18230355, 18651322, 18669888, 18802016, 18977211, 19148342, 19167353, 19450143, 19506371, 19781803, 19858416, 19958400, 20195282, 20413732, 20467793, 20573518, 21663591, 21756880, 21868018, 21975431, 22023473, 22282402, 22293444, 23402987, 23564080, 23564081, 24098801, 24862889, 25655256, 25786118, 26354107, 27592629, 28041913, 28189525, 28246398, 28272702, 28282403, 28536301, 28566450, 28646427, 28672844, 28946319, 28957799, 29098933, 29154780, 29251559, 29378168, 29596634, 29795012, 29864522, 29874658, 29990859, 30006321, 30049285, 30426302, 30918133, 30946765, 31152776, 31203904, 31388753, 31476962, 31737059, 31739217, 31773386, 31797473, 8580375, 8872602, 9366570		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	10413089, 10858246, 11104691, 11403209, 11415454, 14620921, 15056843, 15226634, 15908470, 16474202, 17295000, 17499741, 17587761, 18164016, 18670098, 19148342, 19152916, 19293636, 19332545, 19561397, 19625220, 19958400, 20069129, 20818133, 21859809, 22541858, 23166687, 23402987, 24020822, 24098801, 25786118, 26867220, 27458015, 29098933, 31350345, 35052452, 35860283, 37652021, 38256102, 7614716, 7651403	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	12443832, 15226634, 15466648, 16116069, 16445900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	12677255, 12928151, 20720404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	14998623, 23397981	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	22752804, 23397981, 28886122, 30586705, 31203274		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	34721402	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	30430410	Inhibit	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34128902	Stimulate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21803429, 27217154, 30221723, 30430410		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	20102735	Stimulate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29791472, 31835709		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12358851, 12556201, 19668598, 20153790, 25339674, 25769927, 26318885, 27392463, 29111236, 29390552		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19668598, 33386704, 34752683	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	LHGDN	15745922, 18702954		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	30981714		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29745420, 30061946, 30412733		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	36860843	Associate	★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12739041, 14651522, 15115316, 15248229, 19782713, 22476561, 23928854, 27064875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	15115316, 24984193, 34624603	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	15248229	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	BEFREE	27878431		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19360811, 30816510, 8701989		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	19115220		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	35774294	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	17928143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	17928143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	38484669	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	15034225		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11904733, 16815626, 20449800, 21725879, 22982413, 25911129, 28757590, 29190807, 30237493		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	26293297	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	26667361	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	26967475		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	12823344	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939, 22131127	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	30988503, 31713180		★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	16280328	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Associate	★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	26943967		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	29171996		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35443752	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	22543850	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914, 17394460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	19755790	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	27487732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	22996231, 28025034, 29086194, 7489565		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10891427, 15883814, 16003740, 16155412, 18439751, 19479998, 19885629, 20563852, 20659323, 21344235, 22088941, 22160640, 22584572, 22751110, 22927430, 24164868, 25066918, 25246273, 25744294, 25901081, 25928089, 26514518, 26950462, 26996066, 27820834, 28077158, 28143493, 28475599, 28734227, 29107385, 29133591, 29934505, 30141614, 30151375, 30368555, 30446625, 30671946, 30808421, 31208996, 31710162, 31837540		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15192307, 16003740, 16849564, 17261184, 21486440, 23078970, 23543442, 23991131, 25928089, 26314842, 26514518, 26996066, 27125354, 28420351, 29685151, 30808421, 31659097, 31710162, 32649310, 32986377, 33146700, 34239022, 34775491, 34848446, 36038549, 37341066, 40550227	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36674955	Stimulate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	12388339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	16792687	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis	Bronchiolitis	LHGDN	15602730		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	30936869		★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	11518728, 17442967		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28382003, 30459472		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30459472	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	37090732	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	33047901	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	29727865		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	24367564		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26648448, 33682749, 36674955	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10360812, 16278381, 22088941, 30094610		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	31031757	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25928089, 27903846	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12402381, 23684136, 23874805, 29115520, 33891564, 35955552, 36828281, 37904170, 37976890, 39756577, 40148834	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29556041, 37096803, 38015590	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	10360812		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21486440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11904733, 16815626, 20449800, 21725879, 22982413, 25911129, 28757590, 30237493		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10048981, 10357555, 10727989, 17786042, 23635779, 26733169, 27075927, 27145753, 28981818, 29023999, 29892522, 30061946, 31243299, 9139838		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	39773697	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20579680	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22190968, 25827621	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22699780, 23657965, 27409666, 29905412	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24768357	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33723932, 34177903, 8909236	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12532421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20683396, 21187454, 22210436, 22971726, 24141405, 25234717, 25289731, 26093057, 28886321, 31541326, 31704820, 31788074, 31851935		★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	30586705		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	16804844		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33988313	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17467829, 19632522	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	9811526		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19632522, 9811526		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12928151, 16705055, 18339698, 19014891, 19781803, 22023473, 24008336, 25786118, 25994074, 28371087, 28371433, 28566450, 29098933, 29864522, 30826652, 31109070, 31152776, 31429530, 31557637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	15627719, 19014891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	16332659		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	25786118, 26514518, 29098933, 32806763, 37148770	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	LHGDN	14620921, 16697654		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	Pubtator	14620921, 19506371, 36959587	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	18022660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	BEFREE	21700929		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	14620921, 16445900, 16799229, 18022660, 19506371, 19781803, 20029197, 30946765		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	CTD_human_DG	18022660		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	16308497, 18060801, 19506371, 25441669	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	12408680		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage Diseases	BEFREE	27746376		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29660334, 30262982		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32855850	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37694725, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	31717494	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	9010269		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	29086194		★☆☆☆☆ Found in Text Mining only
Cerebral Aneurysm	Cerebral Aneurysm	BEFREE	19164781, 20428211, 26345838		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	29171996		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22942727	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24720638, 28272702, 30872008		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	30680005		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12556201, 20880493, 23135705, 26296699, 28535201, 29114094, 29249591, 29896433, 30586705, 31476962, 31486527		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10360812, 14681721, 23427179, 24018440		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10360812, 10830724, 16435282, 23427179, 24018440		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	34592495	Associate	★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	20093502, 20591826		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21298741		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	27980102		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21943176, 29474906, 31729527		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	24390753, 34519176	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	20147628		★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	Pubtator	20027300	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	25223582		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17728497, 19014891, 19539174, 22328092, 22817530, 25154422, 31312972, 31847640, 8808219		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	16609683, 21677444, 28476556, 29229532, 29349065, 29481790, 29874658, 29934960, 30109559, 30241508, 30357395, 30516070, 31557637, 31773386, 8808219		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	12944979		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28754746		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10727989, 14624669, 15220136, 16919984, 17406066, 19349390, 20497022, 21097527, 21327296, 22276574, 24111605, 27516147, 28352642, 29872287, 30498444		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	17452470		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	39231552	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28427824, 31847640		★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	17353158		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	29925518		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	10446112, 21229279		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	19929093	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	30688042	Associate	★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	16182380, 26943967, 31356620		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	30858476		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26284520, 29352259, 32634865	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	27530284		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33075233	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	22543850	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37686198	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16920976, 18827968, 20054232, 26146082, 31182817		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10433925, 34298022	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21129005, 22467146, 31584460, 33409535, 33879239	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19016769, 26146082		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	16085694	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	19773434, 26358505		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17390111, 19706805, 26014148, 26146082, 26515597, 27339628, 29262644, 30927925, 30970512, 31545552, 31781676		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16101183, 26515597, 28347237, 28629469, 29154245, 30419802, 31545552, 31781676, 34256095, 34639088, 36693067, 38459704	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30970512	Stimulate	★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	CTD_human_DG	15135227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	19115220		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	30418988		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	30418988		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	30418988		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	30418988		★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	29738371		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	14517168, 16574901, 17395051, 21900689, 25223582, 27835665, 31338525, 31484989, 9780267		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	29959987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Contact Dermatitis	Dermatitis	BEFREE	11378330, 12911787		★☆☆☆☆ Found in Text Mining only
Conus Medullaris Syndrome	Conus Medullaris Syndrome	CTD_human_DG	15135227		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11237430, 19360351, 23657965, 27666332, 29905412, 30537206, 31816951		★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	28584076, 31399604		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	16306213		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	11500196, 16934270		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12239249, 15017357, 15245376, 16934270, 19247801, 19332042, 20116810, 20431065, 21868018, 22752804, 23930970, 25786118, 25875728, 28534120, 30557342, 30586705, 31077149, 31737059, 31739217, 31797473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	11500196, 12239249, 15017357, 15302103, 16164699, 16934270, 17482150, 18230355, 18617279, 18651322, 19247801, 19332042, 19450143, 20431065, 20691218, 21192737, 21679057, 21868018, 22752804, 23930970, 24146036, 25786118, 25875728, 26277553, 28534120, 29067980, 29130961, 29609686, 30557342, 30586705, 30961613, 31388753, 31737059, 31739217, 31797473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	11500196, 16934270		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	16934270, 17486299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	19148342, 19506371, 22780915, 23930970, 25424368, 25786118, 26867220, 27537567, 29067980, 30961613, 33740174, 38459704	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	27458015, 33504180	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	36101804	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	12239249, 15017357, 19247801, 19332042, 20431065, 21868018, 22752804, 23930970, 25786118, 25875728, 28534120, 30557342, 30586705, 31737059, 31739217, 31797473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Restenosis	Coronary restenosis	Pubtator	11999660	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	28389503		★☆☆☆☆ Found in Text Mining only
Craniorachischisis	Craniorachischisis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12904997, 16775490, 20125127, 25620350, 26318885, 7806062		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	20570966, 22467146, 33879239	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	21829567		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	LHGDN	18702954		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	19000946, 20438838, 34721395	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26485688	Associate	★☆☆☆☆ Found in Text Mining only
Cystinosis	Cystinosis	BEFREE	30928021		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	30905425		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	Pubtator	30905425	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	28429334, 28450294, 29201216, 30790336		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10229398, 11238664, 1522232, 15781004, 1624809, 16464743, 22037282, 23185512, 23274856, 25955863, 26578310, 27129293, 27746376, 27894935, 27965260, 28225075, 29723633, 30456760, 30551734, 30845380, 30910989, 30981080, 31196179, 31495394		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	26241646, 29350052, 31271845		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	23385102, 28286770		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	22347417		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	12374865, 15312962, 15857890, 16206198, 17162657, 31414991		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	12374865, 21760952, 9501225	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29247598		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	24786287		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	27733565, 9916917	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25370917, 29894487, 29993042, 30121652, 31788074		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	24424390	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	30870525	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	21311769, 22679019, 28143523, 28780056, 29038621, 30857352		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15370700, 22272250, 32035984, 34070943	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	37187734	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	12911787, 30981714		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	11344355, 29853747, 29989151, 31292344		★☆☆☆☆ Found in Text Mining only
Dermatitis, Occupational	Dermatitis	BEFREE	29132256		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30339714		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	11603815, 17065190, 30764873		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15349727, 15677796, 17968528, 18272603, 19077682, 19587356, 20526368, 21992868, 23549806, 23704830, 24101400, 24382482, 25329075, 25817234, 25994074, 26802601, 28266270, 28380135, 28385802, 30909920, 30988769, 31247201, 31330062		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	21532752	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	31880859, 35390031	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35813663	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15349727, 15677796, 17968528, 18272603, 19077682, 19587356, 20526368, 21992868, 23549806, 23704830, 24101400, 24382482, 25303153, 25329075, 25655256, 25817234, 25994074, 26802601, 28266270, 28380135, 28385802, 29359616, 29896433, 29995756, 30764873, 30909920, 30988769, 31247201, 31330062, 31557637		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	16631114		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18385799, 18670098, 18803760, 20526368, 21203348, 22385239, 23549806, 24382482, 29513874, 34517005, 40065310	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19755790, 22776897, 24521217, 24936866, 25503660, 27123454, 28454543, 34944529	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16045741, 18762729, 21532752, 23624551, 27406064	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	16566827	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	28380011	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17372317, 17982227, 18762729, 23549806, 23930970, 24936866, 25154422, 29641741, 30139387, 32816392, 35960063, 36674502, 39217825	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24429578, 24495560, 27904654	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34944529	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11317664, 11756323, 15135805, 20546673, 21532752, 23624551, 31267721		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15349727, 15472205, 15677796, 16050950, 17372317, 17982227, 18219773, 18272603, 19781803, 20488574, 20960176, 21114970, 21289263, 21890375, 21975431, 23549806, 23704830, 23930970, 24059294, 24809310, 24975639, 25154422, 25913234, 25981750, 26083329, 27505625, 27573980, 27904654, 28266270, 28336215, 28536301, 28802226, 29017158, 29175667, 29227493, 29525039, 29703845, 29785210, 29901584, 30693534, 30909920, 31078135, 31222667, 31250339		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	23549806, 25154422	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	29901584, 29995756	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	29901584	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	10916091, 11012884, 12803507, 17408061, 17728497, 17982227, 19357773, 22629296, 33122288, 34087849, 35363774, 35843953, 35991124, 38013385	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24786705, 29999450	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	11012884, 11912219, 15280531, 17728497, 17968528, 17982227, 18272603, 18579703, 19587356, 20960176, 22006533, 22322482, 24936866, 25280384, 27186953, 28293857, 28837800, 28933050, 29207635, 29434819, 29934960, 29999450, 30147653, 30241508, 30287151, 30357416, 30827272, 31117104, 31250339		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	16374426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17968528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	16730843		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	20488574, 24809310, 25913234, 25981750, 27505625, 27939241, 28336215, 29285153, 30151700, 30607767, 31599399		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	23549806, 33156339	Associate	★☆☆☆☆ Found in Text Mining only
Diastematomyelia	Diastematomyelia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16373702, 28693163, 30374624		★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	33422029	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	31454521		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	19920349		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	17187019		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28267084, 30314728		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	29093484	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	26200497		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27486749	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	29673232	Stimulate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	21203348	Stimulate	★☆☆☆☆ Found in Text Mining only
Duchenne and Becker Muscular Dystrophy	Duchenne And Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30535619, 31557637		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29039974		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	16479072	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11344355, 29853747, 29989151, 31292344		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	34439789	Associate	★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	29872287	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	10068657	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	11574916, 24788844, 28765968, 29202854, 29374213, 29871779, 30863452, 31049785, 31520510, 9708412		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24413261	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	12486156, 15857890, 30936869		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	31710162	Stimulate	★☆☆☆☆ Found in Text Mining only
Endogenous Hyperinsulinism	Endogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16866022, 20364004, 26413869, 27069129, 28843961		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	17380299		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	17380299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36231119	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	BEFREE	28950844		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10690908, 10871649, 11056242, 11213838, 12372465, 14981141, 16687653, 17678915, 19050323, 19933497, 21685244, 22267540, 24939730, 27330011, 28412861, 28433374, 28950844, 29036448, 30838396, 31295376, 9422530, 9647546		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11056242, 12372466, 17678915, 18314120, 24133578, 39458478, 9176445	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12009356, 12372466, 17207568, 17582674, 17706208, 18314120		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22265030, 34360900, 34930225, 39244839, 9422530	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	24732104	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	30455683		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	30455683	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	18402383		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	23996681, 30194729		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	31091126		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26093057, 31541326		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24284961		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24284961		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24284961	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24284961, 26942702, 30683902, 37248653	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	22734465	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	16382212	Stimulate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	21146687		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22697070	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	30540703	Associate	★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	30266980		★☆☆☆☆ Found in Text Mining only
Exogenous Hyperinsulinism	Exogenous Hyperinsulinism	CTD_human_DG	29035695		★☆☆☆☆ Found in Text Mining only
External Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	18022660		★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	28231837, 30002400		★☆☆☆☆ Found in Text Mining only
Exudative retinopathy	Exudative retinopathy	BEFREE	30414256		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	35417091, 40420032	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	26112421		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	27207648, 31287009		★☆☆☆☆ Found in Text Mining only
Farber Lipogranulomatosis	Farber disease	BEFREE	29379059		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	16691291, 28323124, 30905786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	29684222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	23066023, 27967209, 28076416, 28323124, 29666185, 30102772, 30830270, 31585800		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	27903846		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	9627299		★☆☆☆☆ Found in Text Mining only
fibroma	Fibroma	BEFREE	16129702		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	1991962		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	16987036		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12846061, 15492853, 21156192, 28267084, 30458454, 30582979		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	20697377		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	20345941		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	20345941	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	23999007, 26335292, 30597038		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	19494437, 26021560		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	31847785	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	18373164, 30382864		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	23529020		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	18506929	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	30852582	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	15115316		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25120735	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31819043		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	19965620	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	19587377	Stimulate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	28029576		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	15742444, 16621921, 28747747		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	9632113		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	20193755		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	8406859		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	16943231	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31268809		★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	26748993, 33438359	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	36254076	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	34294770	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	40353220	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	30266980		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10644332, 12019157, 17703277, 1937574, 24895995, 26152356, 28025034, 28790339, 29786075, 30041669, 30048972, 30401716, 31183364, 31366997, 31710121, 7517920, 7891669, 8691078		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17522861, 26152356, 30048972, 31467175, 33075233, 33964937, 34987659, 35562953, 35726234, 37662685, 38057698, 9613677	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17703277		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22554389	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10644332, 12019157, 17703277, 19001328, 1937574, 24895995, 26152356, 28025034, 29312296, 29786075, 30041669, 30048972, 30401716, 31183364, 31366997, 31710121, 7517920, 7891669, 8691078		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17522861, 2211704	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19424580, 2211704, 22159219, 2465924, 25445541, 28007636, 28714025, 8189261		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26749234	Stimulate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	7489565		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27217154		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10385480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	10469367, 16436653, 17428349, 24284376	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	16436653, 22203484, 23108091, 28469165, 29414320, 7967509, 8558841, 8587246, 9734607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27788494, 32388684, 37862725, 37908345	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28273242, 39516745	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	10620196	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	33754492	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	11473635, 15561743, 28479222, 29089036, 31222503, 31358596		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	26335292	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	20206286, 24142887, 28765149, 29664944		★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	25119828		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35486633	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26200497, 28013013		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	15807865	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	19117935, 22736938, 25159204, 32663289	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33498689	Stimulate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	24028188		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31845094		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	27245471	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	34925365	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	26026089		★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	11909910	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	28501927	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	28501927	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	17467829, 31077149	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	14517168, 16574901, 21900689, 27835665, 31338525, 31484989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	21900689, 22615818, 34868339	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	29959987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	29959987		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	CTD_human_DG	21335463		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioma	Hemangioma	BEFREE	8769945		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	20872175, 24599340	Associate	★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	27910891	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	LHGDN	17767550		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	25839768, 26234573, 28691415, 28919104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	27655254, 28870240		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	10446112, 22861370	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	22861370	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	24975639, 26919045	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25206284	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	30679661	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15770052	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	8408620	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	9466568	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10193522, 15192307	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38615592	Inhibit	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	17767550, 29115520		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10193522, 24975639, 31557637, 8808219		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10193522	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22289889	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24975639, 31557637, 8808219		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	Pubtator	22744767	Stimulate	★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	23461995, 30651806		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	39252231	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	11755917, 14743961, 20206286, 24269812		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20599797, 23549806, 24600221, 30049285, 30132524, 30502681, 30607767, 30988769, 31136032, 31250339, 31330062, 31616304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	23549806, 25894202	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	17045925, 17407231, 17977907, 18976655, 19858416, 22912384, 31146011		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	LHGDN	17977907		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	15349727, 17180354, 17456576, 18270300, 18334611, 21295959		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemia	Hyperlipidemia	BEFREE	16781696, 29787756, 30905786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperostosis	Hyperostosis	BEFREE	28095896		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	CTD_human_DG	16284884		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperoxia	Hyperoxia	Pubtator	37884440	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	29127344		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16382212, 22697070, 39595551	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	19639050	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension, Renovascular	Hypertension	BEFREE	29872089		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16794480, 18339698, 18977211, 19639050, 20836698, 23114789, 25655256, 27453537, 28380135, 30368514, 31312972, 31427987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	20667508, 27292124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy	Hypertrophy	Pubtator	34876548	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	11750041		★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	20945369		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12020348, 25411969, 26045772, 30402462	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33737938	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37735391	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	11376856		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	11603815, 17065190		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	10620196		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	15302794, 24122720, 28597756, 31320454, 31539149		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10515417, 15879152, 1608944, 30091381, 30619270, 32317146, 33746960, 33755690, 36601116	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15802346	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	1608944, 19060230, 19117745, 23583295, 24583146, 30091381		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	18395486		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	17823354, 24122720		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11158399, 12053063, 14767014, 16362156, 24271554, 27788494, 28273242, 28946966, 28969604, 29230705, 30142333		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	16362156		★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	28511292		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	38057698, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	20153790, 31530029		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10786999, 10891427, 11574916, 19479998, 28225889, 9414293		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25370917, 26284520, 27530284, 28587818, 29171996, 29352259, 31124192		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	22384201, 27863550		★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	20872175		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626, 23043544, 25257527		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12904997, 16792690, 20125127, 25620350, 31484731, 7806062, 8683390		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16792690	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	7806062	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	21311769, 22679019, 28780056, 29038621		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	9624422		★☆☆☆☆ Found in Text Mining only
Iniencephaly	Anencephaly	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18270300, 18762729, 22709547, 26839895, 29694633, 33508012	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26871994	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
insulinoma	Insulinoma	BEFREE	28632169		★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Diseases	Carotid artery disease	CTD_human_DG	18022660		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32572902, 36746221	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	30248387, 36293070	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23887838, 26345838, 33332775	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	24685329, 28174280, 30737656, 30808715, 30867357		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31759251		★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	27343564		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	15883814, 25928089		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	17767550, 29176318		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24667736	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	20880493, 23135705, 23198952, 24083412, 25413568, 29618156, 30586705		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	16835702		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	20038977, 31399604		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37460969	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	22466558, 27393275, 30720053, 31461349, 31680444		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10469367, 10886563, 11012884, 16164630, 16362156, 17261994, 17977907, 18768165, 19357773, 20960176, 21071523, 23872063, 24059294, 24382482, 25655256, 26335292, 26429331, 28433894, 28434946, 28919104, 29073812, 29380373, 30301439, 31242630, 31498850, 31557402, 7967509		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	11012884, 18032547, 20414371, 24382482, 26335292, 37862725, 37942539	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12803507, 8995729	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	11473635, 12039983, 17728497, 17982227, 18272603		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	22817530, 25154422, 26335292	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31875015	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	34602548	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	18753296, 21071523, 24420912, 28223055, 29231123, 29273022, 30077612, 30841537, 30877184, 31242630, 31296157, 31682847		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17728497, 19014891, 19539174, 22328092, 22817530, 25154422, 25280384, 25655256, 28352125, 28765904, 31312972, 31847640, 8808219		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	17943082		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19420110, 19539174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28380135		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	29959987		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	11591415, 36771423, 9627299	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23350010, 34993156, 38244764	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23798993	Inhibit	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	33400985	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24304929	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28045930, 30726736, 7489565		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	30229833	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19034332	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26279521	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	33422029	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17822317		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19388934, 25382729, 25860293, 26279521		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10987310		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28771137		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21570337, 24531940, 28107185		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	16697654		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	18430964		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	18430964	Associate	★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	30142333		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11687892, 12679798, 17182598, 17413295, 18205260, 19016769, 20740585, 22402625, 23089469, 23684136, 25622857, 26065367, 26452628, 27044356, 27668844, 27980102, 28866620, 29113298, 29409972, 29556041, 31154396		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	10446112, 21229279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	20697377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	21527401	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	19938194	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	32871288	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21760952, 9466568	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	10446112	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	22861370, 38146363	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30314728		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	8283136		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10385645, 26452628		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	28306361		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11591574, 16809218, 17908747, 20041183, 23583295, 28407300		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	25289758, 34576979	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10515417, 20404807, 27906425, 37606981	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	28575534, 30764873		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24321786, 25744730, 27145753, 27541266	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25744730, 31660078		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28968774	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12460032, 12584053, 14623950, 25339674, 30268079, 8558841		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15457456, 18793417, 20414371, 22466290, 27814627, 28954264, 31379847, 34624603	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22466290, 24083390, 24292724, 24451065, 24460726, 25401491, 27852285, 31007604, 33708222, 34180358	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12460032, 12584053, 14623950, 25339674, 30268079		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11844145, 11937582, 12358851, 12460032, 12584053, 14623950, 15188361, 15457456, 15468376, 15611878, 16719905, 17407231, 18191726, 19941075, 21163672, 22466290, 22707193, 24292724, 25339674, 26429331, 28433894, 28954264, 29073812, 29181621, 30268079, 30301439, 30414207, 31814187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15188361, 15611878, 18191726		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	11844145, 12460032, 13130475, 15119544, 15188361, 18771958, 19941075, 20231199, 22466290, 24134561, 25339674, 26016809, 26429331, 27392463, 27590021, 28361601, 29073812, 29111236, 29181621, 29390552, 29451067, 29458096, 29653499, 29668584, 30020021, 30712924, 8558841, 8648917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	LHGDN	15188361, 18495743		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	15188361, 15457456, 26762103	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	19021013, 25229495, 38441377	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12460032, 12584053, 14623950, 25339674, 30268079		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	19155472		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16203990	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18525219, 37132640	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30237493		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	LHGDN	18623207		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21744323, 21943176		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21744323, 29504848	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22289889	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22289889		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	21597483, 23185481, 25503251, 29664944, 31857597, 32485729, 39959181	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	28231837, 34721402, 34794403, 35352887, 35370941	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular dystrophy corneal type 1	Macular dystrophy	Pubtator	34794403	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	24319335		★☆☆☆☆ Found in Text Mining only
Macular retinal edema	Macular edema	BEFREE	24319335		★☆☆☆☆ Found in Text Mining only
Majeed syndrome	Majeed syndrome	Pubtator	33314777	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	15296827		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	15296827		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	7586821		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11357878, 22159219, 8189261		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	26026089		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16003740, 16155412, 18439751, 19479998, 19885629, 20563852, 20659323, 21344235, 22088941, 22160640, 22584572, 22751110, 22927430, 24164868, 25066918, 25246273, 25744294, 25901081, 25928089, 26514518, 26950462, 26996066, 27820834, 28041977, 28077158, 28143493, 28475599, 28734227, 29107385, 29133591, 29934505, 30141614, 30151375, 30368555, 30446625, 30671946, 30808421, 31208996, 31710162, 31837540		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16866022, 20364004, 26413869, 28843961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24284961		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26406868		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26452628, 27980102		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10048981, 10357555, 10727989, 17786042, 23635779, 26733169, 27075927, 27145753, 28981818, 29023999, 29892522, 30061946, 31243299, 9139838		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21570337, 24531940, 28107185		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	25199511		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15900302, 20683396, 21187454, 22210436, 22971726, 24141405, 25234717, 25289731, 28886321, 31704820, 31788074, 31851935		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23653148, 29852290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16705739, 17216598, 18611860, 18646053, 19002595, 19099590, 19176388, 19360344, 19866475, 19995900, 21075328, 21135144, 21545229, 21855541, 22612293, 23362217, 23585426, 23982944, 24406043, 24970800, 25266801, 25749044, 25917126, 26327448, 26701731, 27207648, 28424660, 29222347, 29386061, 30426599, 30871130, 31600936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18373164, 21107756, 25411415, 28215642, 28558708, 29422964, 29989092		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29977225, 31762942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11904733, 16815626, 20449800, 21725879, 22982413, 25911129, 28757590, 30237493		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12008042, 17257744, 17786042, 18439751, 19016769, 19192289, 2038321, 20497022, 20563852, 21075328, 21426933, 21943176, 23143679, 23183267, 23349788, 23527025, 23657965, 23876399, 23886148, 24367564, 24384681, 24531940, 25266801, 25289731, 25555218, 26452628, 26514518, 26806351, 27262929, 27666332, 27980102, 28075192, 28077158, 28189389, 28212753, 28339085, 28424406, 28618950, 28714025, 28730964, 28790030, 28886321, 28914666, 29048610, 29115520, 29222347, 29234825, 29337566, 29375123, 29458367, 29594759, 30061946, 30266096, 30540703, 30552233, 30605362, 31217354		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10360812, 23427179, 24018440		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19016769, 19773434, 26146082		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31347485		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16003740, 20563852, 22160640, 23416968, 25744294, 25928089, 28441391, 28466296, 31672785		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18439751, 18790652		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	PSYGENET_DG	24607605		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	27856463		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	27856463	Stimulate	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	27856463	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	27856463		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	29730395		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21943176, 29474906, 31729527		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12020348, 16179869, 1731532, 17991428, 1875058, 19569239, 22498258, 23454771, 24980831, 26729791, 27878431, 31762942		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12020348, 1731532, 1875058, 21646373, 22498258, 26684239, 32002296, 36087066	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17169533		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35538545	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37481560	Inhibit	★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	8812856		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	23999007		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12117909	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	21426933, 7714614		★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25370917, 29894487, 29993042, 30121652, 31788074		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21356356, 23917077, 31823764		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	21356356	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25981750		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26052894, 29067980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	16188961, 18486454		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17322498, 18802016, 19450143, 22013132, 22110764, 23170936, 25639755, 26052894, 29067980, 30924020		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	BEFREE	26684239		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29381686		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	27977881, 31212905		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	37766239	Inhibit	★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	36726727	Associate	★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626, 23043544, 25257527		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25147936		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22543850, 29352259, 30630955, 30790387		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	28349583		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21859809	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36361846, 39174953	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	24184699		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	19923858		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	29621597		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	25199511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	BEFREE	27940361, 31167811		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28072843		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	28072843	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28072843		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	10632983, 16306213, 31169521		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10632983, 40455761	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	15608388, 17456996	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple lipomata	Multiple Lipomata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12357369, 12644822, 15041705, 15813853, 16918137, 21943176, 31611552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	12644822, 12823344, 15287939, 27983725	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	16918137		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	24340030	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11880161, 12486156, 12556201, 14644039, 15191525, 15857890, 19865101, 20456365, 20637631, 24184699, 25149422, 27064875, 28641765, 31203904, 31284389, 31484731, 9628469, 9655469, 9846826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	11909910, 16245210, 37047690	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15257681		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	16872505, 20456365, 31191554, 37848007, 9916917	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	17284607	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	11880161		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	36525882	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	15880317		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	30048972	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27716259		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	25915587, 28508873		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	22000099, 28267084, 30314728		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	29959987		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	14517168, 16116069, 16164699, 16356504, 16799229, 18230355, 19639050, 21910857, 24053559, 25223582, 26662939, 28566450, 29232411, 30586705, 31205590, 31216426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	14517168, 16116069, 18158188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	16799229, 31240830, 31772617	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	22664781	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15245376, 16574901, 19639050, 25413568, 31077149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	19639050	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	11472393, 21168219		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	32963156	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	17065190		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	35363774	Inhibit	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	30764873		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	LHGDN	12520153		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	14687706, 16358608, 19101504		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	17424890		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26067893	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36211987	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17721998, 17975143, 26058873, 28207826, 30368911, 31289447, 31604115		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37925811	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	30048972	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28013313		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10048981, 10360812, 10427991, 10623817, 10679114, 10830724, 10891427, 11156403, 11172294, 11357878, 11570583, 11687892, 12579310, 14681721, 15123743, 15334661, 15883814, 15900302, 16129702, 16278381, 16435282, 16918137, 17257744, 17390111, 17703277, 17727254, 17786042, 17869204, 17975143, 17991428, 18093816, 18373164, 18403751, 18439751, 19002595, 19016769, 19192289, 19424580, 19479998, 19582164, 19706805, 19995900, 20179016, 2038321, 20842059, 20978345, 21075328, 21344235, 21494556, 21531822, 21610146, 21732367, 22020339, 22159219, 22210436, 22406535, 22743317, 22996231, 23131872, 23143679, 23173060, 233662, 23396050, 23427179, 23441216, 23454771, 23527025, 23585426, 23635653, 23635779, 23653148, 24068959, 24531940, 25266801, 25382729, 25492482, 25622857, 25695619, 26014148, 26065367, 26093057, 26115637, 26146082, 26305552, 26327448, 26358505, 26413869, 26430781, 26446946, 26625205, 26684239, 26733169, 26806351, 26950462, 27055731, 27145753, 27207648, 27354473, 27666332, 27820834, 27856463, 27943380, 27980102, 28019655, 28075192, 28096174, 28143493, 28197019, 28212753, 28215642, 28339085, 28347237, 28389503, 28420351, 28458638, 28475599, 28508873, 28570817, 28662055, 28734227, 28763204, 28843961, 29036438, 29107385, 29115520, 29186685, 29337566, 29375123, 29381686, 29517849, 29649286, 29722145, 29746168, 29777108, 29786075, 29892522, 29956585, 30151375, 30158126, 30165193, 30232521, 30237493, 30368555, 30446625, 30458886, 30546951, 30713791, 30927925, 31297636, 31298935, 31366997, 31541326, 31562254, 31604115, 31660078, 31705064, 31710121, 31710162, 31741709, 31763714, 31816951, 31819043, 31823764, 31844158, 7489565, 7669585, 8592656, 8701989, 9139838		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	7489565		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	12460032, 15895897, 17407231, 27814627, 28919104, 29295871		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	12460032, 18656701		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	25492482		★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	BEFREE	30978353		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	22466558, 27393275, 30720053, 31461349, 31680444		★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	18508485	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	11012884		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	11012884	Stimulate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	26335292	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	23916293	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	16206198, 30173917		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	7517920		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	18937353		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	18937353	Associate	★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Neurenteric Cyst	Neurenteric Cyst	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15123743, 17710228, 20842059, 24626857, 25092091, 30761072		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15123743, 25092091, 36923280	Associate	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	22347417		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22366233, 32515902	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15288699, 20681057, 27487732		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	30542122		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34079083	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	29875186		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	20591826		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	21437259	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28771137		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	17721998, 31604115		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	16374426		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	17704301, 26482537, 28323124, 29420066, 29733805, 30746746, 30830270, 31843499		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20449809, 21514686, 25966143, 27145753, 29722145, 30429024, 30578392		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29420066		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29730395, 30132802		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	15520826, 16691291, 16705055, 17372317, 17456576, 17922949, 18270300, 18397542, 18848781, 19240255, 19289381, 19403722, 19450143, 20103702, 22914204, 23017229, 23372021, 23529132, 24030890, 25478993, 25994074, 26273678, 27573980, 28196859, 28266270, 29244802, 29632147, 30174020, 30350467, 30462474, 30535458, 30909920, 31130918, 31218550, 31275296, 31507583, 31677795		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16059715, 17372317, 18762729, 20117442, 20825686, 20846165, 20930711, 21508136, 22688341, 23017229, 23221346, 28125591, 28454543, 33740174, 35301059, 35894174, 35927653, 36613764, 37149591, 37286588	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	24521217, 26273678, 27101398, 28104240, 29244802, 29737494	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	29035695		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	36428961	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Morbid	Obesity	Pubtator	32545403	Stimulate	★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	23429817		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	19755790	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29934505, 31710162		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21418620	Stimulate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	28029690		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11352237, 19303468, 23185512, 25407789, 33953899, 34547432, 34876548, 35094658	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23274856	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21538317, 32006659	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	32006659	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	17763208, 23211090, 26578310, 29723633		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	20068578		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	16027056, 26634954		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	22081934, 27918885, 28177896, 28356494, 28983612, 29061958, 29127344, 30737274		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22081934		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	28983612		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16392133, 2211704, 25695619, 30062520		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31302294, 34335109	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	21029462		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	15900302		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	21187454		★☆☆☆☆ Found in Text Mining only
Ovarian Cysts	Ovarian cysts	Pubtator	26003810	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15900302		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20683396, 21187454, 22210436, 22971726, 24141405, 25234717, 25289731, 28886321, 31704820, 31788074, 31851935		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10427991, 10623817, 15900302, 25234717, 25712684, 35186171, 36766725, 37445830, 9137096	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31396019	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxalosis	Hyperoxaluria	CTD_human_DG	16284884		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	19002595, 23635653		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	28552635		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23653148, 29852290		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20579680, 27354473		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	19176388		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25938165, 30397360	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	15880317, 17922439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	18837094	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	21561713, 25499426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis Chronic	Pancreatitis	Pubtator	16394277	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	18053242	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	31037357		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16394277, 16636603, 16987036, 19844201, 26852168		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30254191		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	27943380		★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	22425139		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	34764955	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12889089, 15488313, 25370917, 26646004, 27940361, 29540296, 30761072, 31001188, 31471711, 31552762		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18678243		★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	31559531	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	12889089		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31559531		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	23200757		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	19816747, 20579680, 30287890		★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	32749463	Stimulate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	LHGDN	18506929		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29066283		★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	31156149		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30392438, 8225596		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	8225596	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	17533151, 22117820, 27925202, 28356494, 30341668, 30392438, 31823136, 31847640		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	17533151, 26241961, 28427824	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34502071	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	28406704	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	30104096	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	21663591, 24101400, 25336430, 28406704, 30988503		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	25336430		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	20591826		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30988503		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28873458		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	19938194, 25206284, 26525345	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	19938194, 20143473, 25206284	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Stimulate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	LHGDN	12127997		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	18704440		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	23549806, 25981750, 28497987, 28654984		★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	27967209		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	31356620		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	CTD_human_DG	10923243		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural effusion disorder	Pleural effusion	BEFREE	21356356, 27878909		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	27878909, 31316511		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	31600749	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	31091126		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	25543187, 27190355, 30209078, 30368514, 31600749		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	23824412, 25902044, 31293514		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	25902044, 36793022	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	24463275, 35328046	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35328046	Stimulate	★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	19758232		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	17065190		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30172946		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16516290		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21298741		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12374865, 15312962, 15857890, 16206198, 17162657, 31414991		★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	30429240		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	28693163		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	29116124		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	18573422	Stimulate	★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	23549806, 24809310, 28497987, 28654984		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	25015355, 28572674, 28600710		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16705739, 17216598, 18611860, 18646053, 19002595, 19099590, 19176388, 19360344, 19866475, 19995900, 21075328, 21135144, 21545229, 21855541, 22612293, 23362217, 23585426, 23982944, 24406043, 24970800, 25266801, 25749044, 25917126, 26327448, 26701731, 27207648, 28424660, 29222347, 29386061, 30426599, 30871130, 31600936, 8701989		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	26306400, 8701989	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	8701989		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16705739, 18646053		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16867220, 17216598, 18611860, 18646053, 19866475, 20019839, 21135144, 21545229, 24970800, 25266801, 28039457, 29386061, 29808619, 30864712, 31600936, 31763714, 33050597, 33514011, 33872295, 35821621, 35931888	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23585426, 25833062		★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	28672892		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	12803507	Stimulate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	18528327, 26335292	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	28552635		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11344355, 18093183, 21311769, 23480385, 23965158, 27859608, 28489469, 29277337, 8345212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	15370700, 23480385, 40534874	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	LHGDN	18093183		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	23965158	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	26505361, 27859608		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29730395, 30132802		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	24083390	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25940417		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	14624669, 16213701, 17050556, 17136983, 19165499, 20497022, 24805101, 26514518, 29872287, 34325599, 36780897	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19229703, 21097527, 21327296	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	34483727	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	15220136, 21647421, 29872287		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	22634619		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	10403930, 19060230, 23583295, 28730919, 28780502, 30540913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	10403930, 12449175	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	16324872, 17720292, 26163174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17431224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	19729668	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	29738371		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30905425		★☆☆☆☆ Found in Text Mining only
Rachischisis	Rachischisis	CTD_human_DG	16596675		★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	38302542	Stimulate	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	1522232		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	21829567		★☆☆☆☆ Found in Text Mining only
Renal Artery Stenosis	Renal Artery Stenosis	BEFREE	29872089		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26406868		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11237430, 16709811, 19360351, 23657965, 29905412, 30537206, 31816951		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18808740		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21939398, 25760323, 28219345, 29934960, 30342194		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	16541021, 22203484, 26429331, 7967509		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31072913		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	21741938, 23437361, 27496101, 31064097		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	23181789	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34987646	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	17284607, 32542038, 33371882	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	19139725		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25981750, 28336215, 31288713		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31810025		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16802342, 31189648		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	22525722		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	28572674		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10229398, 10431483, 10494903, 10946307, 11238664, 12375327, 12826377, 14626631, 1522232, 15818686, 16319097, 16464743, 17530707, 19865101, 20228199, 21339227, 21345291, 22246057, 22354869, 22750227, 24023637, 25779331, 25865479, 26069140, 26223686, 26318885, 27064875, 27530408, 28113136, 28192374, 28336462, 28341837, 28708839, 28912850, 29191223, 29706965, 29794013, 30079994, 30312880, 30366278, 30431436, 30718447, 30804924, 30809737, 31181818, 31849953, 7545093, 8403545, 8507217		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12826377, 15077296, 16835702, 17530707, 18061474		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17982926	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	23454776		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	29872089		★☆☆☆☆ Found in Text Mining only
Sacral agenesis	Sacral Agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	10515417, 12449175, 27259755, 9528906	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10988120, 12449175, 18069417, 9789895		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	18069417		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	24768588	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19192289, 24676787		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	33682749	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	23818101	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15167690, 15389752, 22425139, 24495780, 26906930, 27650194, 28011441, 29410009, 30132802, 31302732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15167690		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18486454		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24984193, 39940697	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	30339714		★☆☆☆☆ Found in Text Mining only
Sciatic Neuropathy	Sciatic Neuropathy	BEFREE	30961664		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11378330, 11592069, 12846061, 15654958, 22245215, 22700848		★☆☆☆☆ Found in Text Mining only
Scleroderma Localized	Scleroderma	Pubtator	37471168	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10403930, 23897225, 24083390, 35674522	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15654958, 32317146, 37246768, 40534874	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	15654958	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	28176921		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29262644, 30228938		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10754216, 15082170		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28472164, 34624603, 35960063	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11236899, 18954908, 26496101, 27782294, 28202856, 28472164, 28834779, 29465571, 29562764, 29568906, 29620667, 29762676, 29769838, 29975792, 30228372, 30720538, 31489646, 31701658		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15860669, 25818534		★☆☆☆☆ Found in Text Mining only
SHORT STATURE, IDIOPATHIC, X-LINKED	SHORT STATURE, IDIOPATHIC, X-LINKED	BEFREE	29620667		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	19468049		★☆☆☆☆ Found in Text Mining only
SIMPSON-GOLABI-BEHMEL SYNDROME, TYPE 1	Simpson-Golabi-Behmel Syndrome	BEFREE	27922090, 31363171		★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	27816731		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848, 38255988	Associate	★☆☆☆☆ Found in Text Mining only
Skin Abnormalities	Skin abnormalities	Pubtator	15370700	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17606602, 28954264	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	11710722, 14632750, 27623398, 27920272, 28954264, 30743203		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	22761257, 39252231	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	30858476		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	22761257, 26354107, 28131740, 31388753		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10048981, 9139838		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	CTD_human_DG	16596675		★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	18937353		★☆☆☆☆ Found in Text Mining only
Spina Bifida Occulta	Spina bifida occulta	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinal Cord Myelodysplasia	Spinal Cord Myelodysplasia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28450545		★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	25441669		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	21442636	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	12375327, 28369789		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12532421, 17721998, 21883707, 24531940, 24905457, 29702196, 31077446, 8909236, 9769472		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18525219		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	25199511		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24284961, 30683902		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11570583, 18525219, 24586454, 25060177, 28533507, 30192802	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27888616	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	18525219		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29722145		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	18525219		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11570583, 27943380, 30192802, 30696630		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29864522, 31077149		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	12775581, 22420243, 31409556		★☆☆☆☆ Found in Text Mining only
Status Dysraphicus	Status Dysraphicus	CTD_human_DG	16596675		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	19490431, 20034406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	30755225		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	19490431, 20034406		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	16691291, 22861370, 28323124, 28710554, 29247122, 30179264, 30905786		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	29684222		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	24676787		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16278381, 18373164, 21107756, 25411415, 28215642, 28558708, 29422964, 29989092		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18373164		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24764682, 25411415, 26438062, 26648448, 29989092, 35000531, 35851310	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	20872175		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17183455, 19292924, 35638254	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19755790	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	27576738		★☆☆☆☆ Found in Text Mining only
Synovial Hypertrophy	Synovial Hypertrophy	BEFREE	27514996		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	31495394		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10403930, 11378330, 11407698, 11592069, 11710722, 12846061, 15654958, 18381789, 18528529, 19032966, 22245215, 22700848, 23782302, 23897225, 24061076, 24583146, 28261202, 28575534, 30076848		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	15654958		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28778711		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	19646633		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	22000099, 28318085		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	37352031	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	37352031	Associate	★☆☆☆☆ Found in Text Mining only
Tethered Cord Syndrome	Primary Tethered cord syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24463275	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	20414371	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	22942727, 25657311, 25988387, 36226612	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	18284633, 22736938, 30452877, 30576385		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23183267, 29977225, 31762942		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	CTD_human_DG	23397585		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Diseases	Thyroid Diseases	BEFREE	27245471, 30539387		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	19072670		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	26037280		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29977225, 31762942		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	28698095		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27245471	Associate	★☆☆☆☆ Found in Text Mining only
TIBIAL MUSCULAR DYSTROPHY, TARDIVE	Tibial muscular dystrophy	BEFREE	22000099		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	37132640	Associate	★☆☆☆☆ Found in Text Mining only
Total Hypotrichosis, Mari type	Hypotrichosis	BEFREE	22861370		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	19646633		★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	30852582	Inhibit	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Stimulate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28075192, 29594759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29594759, 30059519, 31665136, 32627003, 33587979, 34848446, 35715860, 36347994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35268073	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	16129702		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	LHGDN	16129702		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	19912235	Associate	★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	21193197, 21335463		★☆☆☆☆ Found in Text Mining only
Type II Mucolipidosis	Mucolipidosis	BEFREE	31454521		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19392835, 20125127, 25620350, 29644517		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	15296827		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	15296827		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11904733	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20449800, 28618950, 30310111, 34893045, 37915048	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	32080289	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	20526368	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16803512	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26586929	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	9627299		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	11591415	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22429778	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	27878431, 30702560		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	15115316, 16280979, 31669406		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	15115316, 16280979, 20097750	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	16280979, 34294770	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	19668598, 23928854		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	19729323	Stimulate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	28623996	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26908399		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	23115640	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11343976, 11390343, 17717122, 19506371		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16566827, 18453576, 22366233, 23704830, 34079541, 34509916	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	17717122	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	40508061	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	26667361	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	27064875, 29720895, 30158835, 30230985, 31169521		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	29720895	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis of the skin	Vasculitis	BEFREE	11844145		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	19632522	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	28191787, 31832877		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	28191787, 31832877		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	30246883, 30362842		★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform macular dystrophy	Pubtator	34794403	Stimulate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	17194635, 28572674	Stimulate	★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	24428816	Associate	★☆☆☆☆ Found in Text Mining only