CCL5 (C-C motif chemokine ligand 5)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6352
• Gene name: C-C motif chemokine ligand 5
• Gene symbol: CCL5
• Synonyms (NCBI Gene): D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the

miRNA Show/Hide all (417)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005677	hsa-miR-98-5p	ELISA	20589685
MIRT005678	hsa-miR-125a-5p	ELISA	20589685
MIRT053786	hsa-miR-214-3p	ELISA, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	23171795
MIRT437504	hsa-miR-146a-5p	Luciferase reporter assay	24996260
MIRT685370	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685369	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685368	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685367	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685366	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685365	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685364	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685363	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685362	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685361	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685360	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685359	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685358	hsa-miR-302e	HITS-CLIP	23313552
MIRT685357	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685356	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685355	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685354	hsa-miR-520b	HITS-CLIP	23313552
MIRT685353	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685352	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685351	hsa-miR-520e	HITS-CLIP	23313552
MIRT518354	hsa-miR-4438	HITS-CLIP	23313552
MIRT685350	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT518353	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT685349	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685348	hsa-miR-520h	HITS-CLIP	23313552
MIRT685347	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT685346	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT518351	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT518350	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685345	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685344	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT518344	hsa-miR-5095	HITS-CLIP	23313552
MIRT518343	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT685343	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT685342	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT685341	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT518342	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT518355	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT518354	hsa-miR-4438	PAR-CLIP	23446348
MIRT518353	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT518352	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT518351	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT518350	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT518349	hsa-miR-6853-5p	PAR-CLIP	23446348
MIRT518348	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT518347	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT518346	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT518345	hsa-miR-4775	PAR-CLIP	23446348
MIRT518344	hsa-miR-5095	PAR-CLIP	23446348
MIRT518343	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT518342	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT005677	hsa-miR-98-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	26126865
MIRT733067	hsa-miR-147a	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	31884861
MIRT736398	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT736407	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT685370	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT685369	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT685368	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT685367	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT685366	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT685365	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT685364	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT685363	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT685362	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT685361	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT685360	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT685359	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT685358	hsa-miR-302e	HITS-CLIP	23313552
MIRT685357	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT685356	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT685355	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT685354	hsa-miR-520b	HITS-CLIP	23313552
MIRT685353	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT685352	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT685351	hsa-miR-520e	HITS-CLIP	23313552
MIRT518354	hsa-miR-4438	HITS-CLIP	23313552
MIRT685350	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT518353	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT685349	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT685348	hsa-miR-520h	HITS-CLIP	23313552
MIRT685347	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT685346	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT518351	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT518350	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT685345	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT685344	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT518344	hsa-miR-5095	HITS-CLIP	23313552
MIRT518343	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT685343	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT685342	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT685341	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT518342	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT518355	hsa-miR-590-3p	PAR-CLIP	23446348
MIRT518354	hsa-miR-4438	PAR-CLIP	23446348
MIRT518353	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT518352	hsa-miR-4735-5p	PAR-CLIP	23446348
MIRT518351	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT518350	hsa-miR-6506-5p	PAR-CLIP	23446348
MIRT518349	hsa-miR-6853-5p	PAR-CLIP	23446348
MIRT518348	hsa-miR-4640-5p	PAR-CLIP	23446348
MIRT518347	hsa-miR-4726-5p	PAR-CLIP	23446348
MIRT518346	hsa-miR-6508-3p	PAR-CLIP	23446348
MIRT518345	hsa-miR-4775	PAR-CLIP	23446348
MIRT518344	hsa-miR-5095	PAR-CLIP	23446348
MIRT518343	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT518342	hsa-miR-5089-5p	PAR-CLIP	23446348
MIRT755398	hsa-miR-6499-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34697152
MIRT755534	hsa-miR-149-5p	qRT-PCR	36250208
MIRT871061	hsa-miR-106a	CLIP-seq
MIRT871062	hsa-miR-106b	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT871066	hsa-miR-1245	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871070	hsa-miR-1343	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871072	hsa-miR-150	CLIP-seq
MIRT871073	hsa-miR-17	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871075	hsa-miR-20a	CLIP-seq
MIRT871076	hsa-miR-20b	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871078	hsa-miR-302a	CLIP-seq
MIRT871079	hsa-miR-302b	CLIP-seq
MIRT871080	hsa-miR-302c	CLIP-seq
MIRT871081	hsa-miR-302d	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT871084	hsa-miR-3616-5p	CLIP-seq
MIRT871085	hsa-miR-3647-5p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT871087	hsa-miR-3663-5p	CLIP-seq
MIRT871088	hsa-miR-3667-3p	CLIP-seq
MIRT871089	hsa-miR-3672	CLIP-seq
MIRT871090	hsa-miR-372	CLIP-seq
MIRT871091	hsa-miR-373	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871101	hsa-miR-4728-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT871103	hsa-miR-4757-5p	CLIP-seq
MIRT871104	hsa-miR-4795-5p	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT871107	hsa-miR-518d-5p	CLIP-seq
MIRT871108	hsa-miR-519b-5p	CLIP-seq
MIRT871109	hsa-miR-519c-5p	CLIP-seq
MIRT871110	hsa-miR-519d	CLIP-seq
MIRT871111	hsa-miR-520c-5p	CLIP-seq
MIRT871112	hsa-miR-520g	CLIP-seq
MIRT871113	hsa-miR-526a	CLIP-seq
MIRT871114	hsa-miR-573	CLIP-seq
MIRT871115	hsa-miR-617	CLIP-seq
MIRT871116	hsa-miR-628-5p	CLIP-seq
MIRT871117	hsa-miR-640	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871119	hsa-miR-93	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT871066	hsa-miR-1245	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT1958650	hsa-miR-3187-3p	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT871084	hsa-miR-3616-5p	CLIP-seq
MIRT871085	hsa-miR-3647-5p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT871087	hsa-miR-3663-5p	CLIP-seq
MIRT871089	hsa-miR-3672	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT1958651	hsa-miR-4435	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT1958652	hsa-miR-4701-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT1958653	hsa-miR-4755-3p	CLIP-seq
MIRT1958654	hsa-miR-4781-3p	CLIP-seq
MIRT871104	hsa-miR-4795-5p	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT1958655	hsa-miR-548s	CLIP-seq
MIRT871114	hsa-miR-573	CLIP-seq
MIRT1958656	hsa-miR-588	CLIP-seq
MIRT871115	hsa-miR-617	CLIP-seq
MIRT871117	hsa-miR-640	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT1958650	hsa-miR-3187-3p	CLIP-seq
MIRT871084	hsa-miR-3616-5p	CLIP-seq
MIRT871085	hsa-miR-3647-5p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT871087	hsa-miR-3663-5p	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT1958651	hsa-miR-4435	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT1958652	hsa-miR-4701-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT1958653	hsa-miR-4755-3p	CLIP-seq
MIRT1958654	hsa-miR-4781-3p	CLIP-seq
MIRT871104	hsa-miR-4795-5p	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT1958655	hsa-miR-548s	CLIP-seq
MIRT871114	hsa-miR-573	CLIP-seq
MIRT1958656	hsa-miR-588	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT2385693	hsa-miR-2110	CLIP-seq
MIRT2385694	hsa-miR-4271	CLIP-seq
MIRT2385695	hsa-miR-4667-5p	CLIP-seq
MIRT2385696	hsa-miR-4700-5p	CLIP-seq
MIRT2385697	hsa-miR-4725-3p	CLIP-seq
MIRT2385698	hsa-miR-4747-5p	CLIP-seq
MIRT2385699	hsa-miR-661	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT871061	hsa-miR-106a	CLIP-seq
MIRT871062	hsa-miR-106b	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT2498646	hsa-miR-1285	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871070	hsa-miR-1343	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT2498647	hsa-miR-147	CLIP-seq
MIRT871072	hsa-miR-150	CLIP-seq
MIRT871073	hsa-miR-17	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT871075	hsa-miR-20a	CLIP-seq
MIRT871076	hsa-miR-20b	CLIP-seq
MIRT2385693	hsa-miR-2110	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT2498648	hsa-miR-296-5p	CLIP-seq
MIRT871078	hsa-miR-302a	CLIP-seq
MIRT871079	hsa-miR-302b	CLIP-seq
MIRT871080	hsa-miR-302c	CLIP-seq
MIRT871081	hsa-miR-302d	CLIP-seq
MIRT2498649	hsa-miR-3074-5p	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2498650	hsa-miR-3150a-3p	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT2498651	hsa-miR-3174	CLIP-seq
MIRT2498652	hsa-miR-3187-5p	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT2498653	hsa-miR-330-3p	CLIP-seq
MIRT2498654	hsa-miR-3529	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2498655	hsa-miR-3656	CLIP-seq
MIRT871090	hsa-miR-372	CLIP-seq
MIRT871091	hsa-miR-373	CLIP-seq
MIRT2498656	hsa-miR-378g	CLIP-seq
MIRT2498657	hsa-miR-379	CLIP-seq
MIRT2498658	hsa-miR-3911	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT2498659	hsa-miR-4259	CLIP-seq
MIRT2385694	hsa-miR-4271	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT2498660	hsa-miR-4451	CLIP-seq
MIRT2498661	hsa-miR-4486	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT2498662	hsa-miR-4536	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT2498663	hsa-miR-4650-3p	CLIP-seq
MIRT2385695	hsa-miR-4667-5p	CLIP-seq
MIRT2385696	hsa-miR-4700-5p	CLIP-seq
MIRT2498664	hsa-miR-4715-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT2385697	hsa-miR-4725-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT2385698	hsa-miR-4747-5p	CLIP-seq
MIRT871103	hsa-miR-4757-5p	CLIP-seq
MIRT2498665	hsa-miR-503	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT871110	hsa-miR-519d	CLIP-seq
MIRT871112	hsa-miR-520g	CLIP-seq
MIRT2498666	hsa-miR-612	CLIP-seq
MIRT2498667	hsa-miR-644	CLIP-seq
MIRT2498668	hsa-miR-645	CLIP-seq
MIRT2385699	hsa-miR-661	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq
MIRT2498669	hsa-miR-921	CLIP-seq
MIRT871119	hsa-miR-93	CLIP-seq
MIRT871063	hsa-miR-1184	CLIP-seq
MIRT871064	hsa-miR-122	CLIP-seq
MIRT871065	hsa-miR-1224-3p	CLIP-seq
MIRT871066	hsa-miR-1245	CLIP-seq
MIRT2446475	hsa-miR-1273f	CLIP-seq
MIRT871067	hsa-miR-1281	CLIP-seq
MIRT871068	hsa-miR-129-5p	CLIP-seq
MIRT871069	hsa-miR-1307	CLIP-seq
MIRT871070	hsa-miR-1343	CLIP-seq
MIRT871071	hsa-miR-139-3p	CLIP-seq
MIRT871074	hsa-miR-1976	CLIP-seq
MIRT2385693	hsa-miR-2110	CLIP-seq
MIRT1958649	hsa-miR-216a	CLIP-seq
MIRT871077	hsa-miR-2276	CLIP-seq
MIRT871082	hsa-miR-3135b	CLIP-seq
MIRT2446476	hsa-miR-3149	CLIP-seq
MIRT2498650	hsa-miR-3150a-3p	CLIP-seq
MIRT2446477	hsa-miR-3170	CLIP-seq
MIRT871083	hsa-miR-3199	CLIP-seq
MIRT2498653	hsa-miR-330-3p	CLIP-seq
MIRT871086	hsa-miR-3652	CLIP-seq
MIRT2446478	hsa-miR-411	CLIP-seq
MIRT2498659	hsa-miR-4259	CLIP-seq
MIRT2385694	hsa-miR-4271	CLIP-seq
MIRT871092	hsa-miR-4279	CLIP-seq
MIRT871093	hsa-miR-4284	CLIP-seq
MIRT871094	hsa-miR-4294	CLIP-seq
MIRT871095	hsa-miR-4418	CLIP-seq
MIRT871096	hsa-miR-4430	CLIP-seq
MIRT871097	hsa-miR-4532	CLIP-seq
MIRT871098	hsa-miR-4634	CLIP-seq
MIRT871099	hsa-miR-4638-5p	CLIP-seq
MIRT2498664	hsa-miR-4715-5p	CLIP-seq
MIRT871100	hsa-miR-4722-3p	CLIP-seq
MIRT2385697	hsa-miR-4725-3p	CLIP-seq
MIRT871102	hsa-miR-4740-3p	CLIP-seq
MIRT871103	hsa-miR-4757-5p	CLIP-seq
MIRT2498665	hsa-miR-503	CLIP-seq
MIRT871105	hsa-miR-509-3-5p	CLIP-seq
MIRT871106	hsa-miR-509-5p	CLIP-seq
MIRT871117	hsa-miR-640	CLIP-seq
MIRT2498668	hsa-miR-645	CLIP-seq
MIRT871118	hsa-miR-720	CLIP-seq

Transcription factors Show/Hide all (16)

Transcription factor	Regulation	Reference
ATF3	Unknown	10760799
CREB1	Unknown	11413310
IRF1	Unknown	10385645
IRF3	Unknown	10385645;20483755
IRF7	Unknown	10385645
JUN	Unknown	11413310
JUND	Unknown	10760799
KLF13	Unknown	17513757;22797700
NFKB1	Activation	11478739;9120310
NFKB1	Unknown	11259372;11389171;11413310;12122011;19786024
NFKBIA	Repression	15228586
REL	Unknown	11259372
RELA	Activation	11478739;9120310
RELA	Unknown	11259372;11389171;11413310;12122011;19786024
SP1	Unknown	11259372
SPI1	Unknown	10760799

Gene ontology (GO) Show/Hide all (104)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	TAS	18337562
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0002676	Process	Regulation of chronic inflammatory response	TAS	10488085
GO:0004435	Function	Phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IDA	10734056
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	8699119, 23480650, 28381538
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IC	29772059
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	NAS	1380064
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	8558019
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17001303, 23979485
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007267	Process	Cell-cell signaling	IDA	8558019
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	1699135, 9417081, 29772059
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	NAS	7524281
GO:0009615	Process	Response to virus	TAS	10488085
GO:0009636	Process	Response to toxic substance	IDA	10841574
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IDA	16778803
GO:0010820	Process	Positive regulation of T cell chemotaxis	IDA	1699135, 7544376, 16778803, 18337562
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IDA	21297082
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IDA	10488085
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673
GO:0031583	Process	Phospholipase D-activating G protein-coupled receptor signaling pathway	IDA	9469451
GO:0031726	Function	CCR1 chemokine receptor binding	IDA	10910894
GO:0031726	Function	CCR1 chemokine receptor binding	IEA
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 8699119, 10660125, 10734056
GO:0031726	Function	CCR1 chemokine receptor binding	TAS	9417081
GO:0031729	Function	CCR4 chemokine receptor binding	TAS	9417081
GO:0031730	Function	CCR5 chemokine receptor binding	IPI	9139699
GO:0032008	Process	Positive regulation of TOR signaling	IDA	18337562
GO:0033634	Process	Positive regulation of cell-cell adhesion mediated by integrin	IDA	8558019
GO:0034097	Process	Response to cytokine	IEA
GO:0034112	Process	Positive regulation of homotypic cell-cell adhesion	IDA	10488085
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0035689	Process	Chemokine (C-C motif) ligand 5 signaling pathway	IDA	9417081
GO:0042056	Function	Chemoattractant activity	IDA	15001559
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	18832695
GO:0042119	Process	Neutrophil activation	IDA	10488085
GO:0042379	Function	Chemokine receptor binding	IPI	7517217, 9139699
GO:0042802	Function	Identical protein binding	IPI	15530372, 21827949, 23480650, 28381538
GO:0042803	Function	Protein homodimerization activity	IPI	10488085
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	10841574
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEP	9407497
GO:0045070	Process	Positive regulation of viral genome replication	TAS	10488085
GO:0045071	Process	Negative regulation of viral genome replication	IDA	10490959
GO:0045089	Process	Positive regulation of innate immune response	TAS	21148810
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	10734056
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	17001303
GO:0045785	Process	Positive regulation of cell adhesion	IDA	10910894
GO:0045948	Process	Positive regulation of translational initiation	NAS	18337562
GO:0046817	Function	Chemokine receptor antagonist activity	IDA	8631850
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	16778803
GO:0048246	Process	Macrophage chemotaxis	TAS	18337562
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21297082
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050796	Process	Regulation of insulin secretion	IDA	23979485
GO:0050863	Process	Regulation of T cell activation	IDA	10488085
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7544376
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	8699119
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	23276697
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	17001303, 23276697
GO:0070098	Process	Chemokine-mediated signaling pathway	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	TAS	18337562
GO:0070100	Process	Negative regulation of chemokine-mediated signaling pathway	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IDA	10488085
GO:0070234	Process	Positive regulation of T cell apoptotic process	IDA	10488085
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16314496
GO:0071346	Process	Cellular response to type II interferon	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	1699135, 19779041
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	TAS	11278738
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0150078	Process	Positive regulation of neuroinflammatory response	IDA	24854121
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:0150078	Process	Positive regulation of neuroinflammatory response	ISS
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	9417081
GO:2000110	Process	Negative regulation of macrophage apoptotic process	IEA
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 187011
• HGNC: 10632
• e!Ensembl: ENSG00000271503

Protein

• UniProt ID: P13501
• Protein name: C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68); RANTES(4-68)]
• Protein function: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major
• PDB: 1B3A , 1EQT , 1HRJ , 1RTN , 1RTO , 1U4L , 1U4M , 1U4P , 1U4R , 2L9H , 2VXW , 5CMD , 5COY , 5DNF , 5L2U , 5UIW , 6AEZ , 6C6D , 6FGP , 6LOG , 6STK , 7F1R , 7O7F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the follicular fluid (at protein level). T-cell and macrophage specific. {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2456327}.
• Sequence:

  MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
  AVVFVTRKNRQVCANPEKKWVREYINSLEMS

• Sequence length: 91

Pathways

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Chemokine receptors bind chemokines
Viral protein interaction with cytokine and cytokine receptor	G alpha (i) signalling events
Chemokine signaling pathway	Interleukin-10 signaling
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Prion disease
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease
Human cytomegalovirus infection
Influenza A
Herpes simplex virus 1 infection
Rheumatoid arthritis
Lipid and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Human immunodeficiency virus type 1, rapid disease progression with infection by	Pathogenic	rs2280789	RCV000013577	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (18)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	8534483	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCL5-related condition	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	18249437	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	CTD, Disgenet CTD, Disgenet	10385480	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, ALCOHOLIC	—	CTD	12586603	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	21227906	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Human immunodeficiency virus type 1, delayed disease progression with infection by	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROXALURIA	—	CTD, Disgenet CTD, Disgenet	16284884	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	12126966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	25162674	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	17620002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (530)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	28193081		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	28193081		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15927671		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17207890		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	30834503		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12473593, 17653092, 21978170, 31221150		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30867568		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	19874825		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	24938715		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21767511		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15064621, 27667736, 28259510		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	22444510		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17620002		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19395124, 22272623, 30092003, 34556089	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21942811	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	15488313		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29871926		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29592817	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophy, monomelic	Monomelic Amyotrophy	BEFREE	27956076		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	17018392		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	23900864, 32411797	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	30006250		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	22664781	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	25424368	Stimulate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27991933		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	25022969	Stimulate	★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	19628738		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	16524739		★☆☆☆☆ Found in Text Mining only
Anthracosis	Anterior uveitis	Pubtator	16524739	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344, 27126477, 34495251	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	33858751	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23792449		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	30918467	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15890969, 15899487, 16225753, 21133894, 21839152, 28411140, 29364220, 30006564, 8981204		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10881738, 16507178, 24368568		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	16489254		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16507178	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	16507178, 19333930, 20127724	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	10086850	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16323244, 30181004	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10337033, 16107514	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12176812, 12588667, 12909630, 15331395, 19740335, 22401175, 26314565, 27411480, 28619088, 31037071, 34484236, 37845777, 39830504, 7521808, 7545093, 7680648	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	10881738		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10386610, 11197694, 11544456, 12789231, 14607956, 15592421, 15715189, 15894599, 16024972, 16855620, 17117952, 17302903, 17678722, 17990036, 18178867, 18186796, 18385174, 20186291, 20430255, 22444510, 23267209, 23524653, 24053708, 24963658, 25898691, 28168862, 28257236, 29297467, 29411555, 8970374, 8998072, 9363922		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	10386610, 12204866, 1380064, 15715189, 16024972, 18178867, 19127215, 20371397, 20523058, 23267209, 24053708, 24641287, 29297467, 35791991, 8977128, 9625753	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12789231, 17075265, 17990036, 18385174		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	40696647	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	8534483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10713367, 11160334, 17395328, 28109979		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15890969, 15899487, 16225753, 21133894, 21839152, 28411140, 30006564, 8981204		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15890969		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17622311, 21547257, 34122426, 35795669, 38256102	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35422816	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	10713092	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16410300, 16855620, 27832278		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	12660426		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	14651522		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	23336215	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19360811, 30816510, 30958912		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	29070776	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	12126966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	12126966		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	29554045		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	14565645		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12181060	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	36539847	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	28340601	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12455185, 16161154, 16899591, 18439751, 20811677, 22088941, 22380870, 22637726, 23266888, 25171476, 25256399, 25901081, 25928089, 26173622, 26249173, 26375811, 27027351, 27863423, 29107385, 29216863, 29299159, 29707128, 29758926, 29870666, 29988769, 30850664, 30990165, 31578575, 31691056, 31724785		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10880401, 17159920, 21486440, 22380870, 23074171, 23370279, 24396281, 24691968, 25171476, 25714853, 25928089, 26173622, 26314842, 29758926, 30808421, 31578575, 31659097, 31724785, 33146700, 33671956, 35725915, 37890164, 40496857	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33245226	Stimulate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	10385480		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	12789231, 17990036		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	LHGDN	12139952, 15602730		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	12139952, 12964123, 18162936, 19005677, 21617311, 22444510, 28306146, 28368490, 29253610		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	29253610	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	28168862		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17207890	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22088941		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	29549020	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	31031757	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15770052	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29436633, 31479523, 32730361, 34045534, 36332449, 36513250, 36960063	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34218795	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21486440	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12473593, 17416433, 17653092		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32923157, 40269781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26587829, 32081834, 33173412, 35043231, 35982911, 36854280, 37902279, 39333254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33177244	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37799074	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12660426		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26093057, 26983899		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17488389, 20400278, 24934326, 31396527		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	18060801	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	18060801	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	34224495	Stimulate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	11465714	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	37694725	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16078996		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	35833818, 36439158	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	18696265		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	21376715, 28768648		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39675594	Associate	★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas cardiomyopathy	Pubtator	23150742	Stimulate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	20371397, 24053708		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35033156	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	LHGDN	17519498		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	25301739, 25444917, 27166194		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15899487, 17728497		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29301137, 30280599		★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	28011329		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16029496, 18385174		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16864713, 18385174, 30978114		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	8831850		★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	Pubtator	29116124	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	21610221, 26215124		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19395124	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27261270, 30037025		★☆☆☆☆ Found in Text Mining only
Colitis Collagenous	Collagenous colitis	Pubtator	25948880	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16565224	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22205974, 22282655, 25546229, 31505877		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22205974		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22205974, 22282655, 25671296, 29872080, 29991744, 30871911, 31505877		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16101183, 22593190, 25671296, 29606345, 29872080, 30016783, 30411783, 30554073, 32552875, 34331023, 34539647, 35208526, 35213358, 38212126	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35429245	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Cold	Common cold	Pubtator	11576073	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	31200663		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30370655		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15017357, 15302103, 17504241, 19201454, 21547257, 21839152, 23071760, 23312573, 24085453		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15017357, 15302103, 17504241, 19201454, 21547257, 21679057, 21839152, 22384011, 23071760, 23312573, 24085453, 25183015, 27862306		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17504241		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17504241	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17504241, 21547257, 22384011, 22664781, 24699314, 25424368, 34573427, 35795669, 40594750	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15017357, 17504241, 19201454, 21547257, 21839152, 23071760, 23312573, 24085453		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	28842514	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28337255		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15492753, 16565224, 21351204, 23575333		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16565224	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	16911685, 17519498		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28273887, 29556615	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	24364468, 28821422		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12507912, 31118097		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	12507912, 31118097	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10229398, 10337033, 10881738, 15389872, 22401175, 29093715		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	25623966		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	11091283	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	11223159, 28928746		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31307953		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29038621		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15715189, 22272250, 31855303, 32280674, 39599592	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	10792507	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	8980953	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10640782, 11344355, 15591815, 15715189, 15948978, 17117952, 24996260, 25607251, 8906106		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	17117952		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	28193081		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20400278, 20805685, 29513874		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	34573427	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17016617, 20400278, 20805685, 24938715, 29513874		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18385799, 24936866	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24301906, 26268591, 29498364, 29513874, 30184318, 34573427, 40594750	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24936866, 34573427	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16855620, 30447278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12610055, 15899487, 18426815, 26945994, 27898058, 28936426, 29364220, 30536157, 30961396		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	17728497, 29207157, 36726458, 37656997, 37986381	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	12610055		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12610055, 16442182, 17728497, 18217191, 20203694, 24936866		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26268591	Stimulate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16373702, 21701779, 24938715		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	37876509	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10640782, 11344355, 15591815, 15715189, 15948978, 17117952, 24996260, 25607251, 8906106		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	18249437		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	24413261	Stimulate	★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	29498364	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	27069129		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27069129		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12200463, 17678915		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12200463, 12837926, 16159934, 17261287, 20732991, 31427176, 9141560		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	17678915	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	10069878, 8829474, 9032215		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	26047816	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21921589	Stimulate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26093057		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	15226608, 33323552	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26317795	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36514094, 36680938	Associate	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	33478117	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27639593		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27639593, 29760499		★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	31443758		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8864755		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	20978355, 27639593, 31200663, 31805036		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	14704722	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	19846984		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11079620	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	10895380, 11299056, 11844139, 15079760		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	11472436	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22425022, 28380429, 29399410, 29760190, 31747383		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32545571, 40076291	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21900396, 22425022, 28380429, 29399410, 29760190, 31747383		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21900396, 26585233, 31593589		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21900396, 31593589	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26749234, 31649684	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	10385480		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	16436653, 17428349	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	16436653, 9734607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	16555943, 27044423	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	10620196, 30865617	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	28687251	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	17984846, 23207898		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	15807865	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	12794168, 12864798, 16410300		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	22506015	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	27245471	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	18415893		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36266640	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30370655		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35346191, 36420258, 38065888, 39675594	Associate	★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	28282868	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	37175780	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	33574979	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	21422116	Stimulate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	12415593, 25839768		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	34938356	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31200663	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	31200663	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15770052	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	16437690, 25022296, 27304910	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	15770052	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	22048272	Stimulate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10194423, 18070985	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21767511, 27638007		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18367595, 24360910, 27638007		★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	34119324	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17016617		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18426815, 29402837		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	16225753		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	LHGDN	17112859		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	29794461		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	CTD_human_DG	16284884		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypersensitivity Delayed	Hypersensitivity	Pubtator	7513016	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33974269	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26873938, 28279813		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	11750041		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10427991, 30459756	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22380870, 27129235	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30778913, 33737938	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11850348, 24993099, 29374556, 31320454		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19117745		★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	27044423	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	11158399, 26058859		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29504363		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10364494, 10698152, 16778803, 22282655		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11354628, 16565224, 8683390		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16565224	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	36726458	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29038621		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24895488, 34573427	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34119324	Stimulate	★☆☆☆☆ Found in Text Mining only
Internal Carotid Artery Stenosis	Internal Carotid Artery Stenosis	BEFREE	31642817		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	36293070	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14704722	Inhibit	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	23887838	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hypertension	Intracranial hypertension	Pubtator	17417600	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23198952		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	16507178		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19333930		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	9323208		★☆☆☆☆ Found in Text Mining only
Keratitis Ichthyosis Deafness Syndrome	Keratitis ichthyosis deafness syndrome	Pubtator	30150638	Inhibit	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37460969	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	30327172		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12610055, 31557402		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21533139, 34573427	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17728497		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30700847		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	15899487, 17728497		★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	8188667	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26081440, 31955503, 39191856, 39506790	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30396908	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	LHGDN	15645140		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19388934, 31811114		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	17560067		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20729133		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19632304, 21610221, 22374185, 23292657, 23402366, 28011329, 29156819, 29436633, 29665135, 31186238, 31479523		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	21610221, 26215124		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	28467457	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	31200663	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	40596471	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31200663	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35726350	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19632304		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	36332449	Associate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	21616095		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12388374, 14514472, 9192918	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	36255321	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	9533940		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17653092, 25305322, 31855281, 32549766, 35910766	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19073147		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	26568320	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20589685, 28954264	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23298254, 27852285	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14596426, 15468376, 16032408, 16719905, 16756635, 18191726, 20589685, 23832290, 31479651		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	16756635, 18771958, 29653499		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	17585540		★☆☆☆☆ Found in Text Mining only
Lupus Vasculitis, Central Nervous System	Central nervous system lupus	BEFREE	15468376		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19846984, 22380870	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31578575	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	9533940		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12949794, 17540847, 21744323		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20038229	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	20038229		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10446961		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	21671128		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10393857	Inhibit	★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	18362077		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	23639073	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Cystosarcoma Phyllodes	Cystosarcoma Phyllodes	BEFREE	30890553		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28380429		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25162674		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16161154, 16899591, 18439751, 20811677, 22088941, 22380870, 22637726, 23266888, 25171476, 25256399, 25901081, 25928089, 26173622, 26249173, 26375811, 27027351, 27863423, 29107385, 29216863, 29299159, 29707128, 29758926, 29870666, 29988769, 30850664, 30990165, 31578575, 31691056, 31724785		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12473593, 17416433, 17653092		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20729133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26983899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10881930, 16614115, 22205974, 29358632		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16161154, 19099590, 23362217, 23792449, 23876400, 29288523, 30200999, 31018021, 31173214		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16270531, 19846984, 24323564, 29772686		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15860458, 16270531, 18439751, 19626052, 20233026, 22205974, 22380870, 22494696, 23957698, 24204919, 27262929, 27863423, 27991933, 28416485, 28901496, 28903357, 29299159, 29559701, 31221150, 31593589, 31724785		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22205974, 22282655, 25546229, 31505877		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18439751, 18790652		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20053993, 23266888, 25171476, 27707838, 28731284, 29216863		★☆☆☆☆ Found in Text Mining only
Mannose-Binding Protein Deficiency	Mannose-Binding Protein Deficiency	BEFREE	26745156		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	29730395		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11369232	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18198213		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19626052, 22205974, 22418780, 23370279, 28624449, 29078276		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25944800, 29368981, 37730606	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36443341	Associate	★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	24961438		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12117909	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31307953		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25162674	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27898058, 29991744		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30916180		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	24453419, 25928531	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20622890, 25271422	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	28072843	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	28072843		★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	28072843		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	12808325, 21418786		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33188570	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	12864798		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17540847, 27102001		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27983725	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	10079101, 11389171, 11696431, 11966770, 12909630, 31191554, 9584001, 9916917	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10960051, 11086101, 11091283, 11223159, 15471370, 16855620, 17560067, 17884183, 18336625, 28928746, 30031282, 9584001, 9628469, 9725792, 9846826		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	15471370, 18336625		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	10808056		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	37830588	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	16272363		★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	16272363	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	30314728		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	21547257, 29381915	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	21547257, 24934326, 30006564, 31205590		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22664781	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	40114239	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33530452	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	11123334, 11892044, 14687706, 18802357, 23054685, 9532637, 9761019		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	22344830, 28842563, 36211987, 8876553	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	32085629	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	17721998, 21874234, 29569795		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22226739, 29569795	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12473593, 12949794, 18439751, 19779041, 19995900, 20233026, 22282655, 22323527, 23074171, 23266888, 23402366, 24129241, 25178650, 25330803, 25365225, 25444917, 25546229, 25712684, 25745085, 26093057, 26238785, 26375811, 26406376, 26585233, 27166194, 27863423, 27991933, 28380429, 28389593, 28458638, 28624449, 28731284, 28763204, 28835422, 28868628, 29088737, 29107385, 29216863, 29303012, 29368981, 29399390, 29559701, 29872080, 29988769, 29991744, 30125329, 30309853, 30554073, 30834503, 30867568, 30871911, 31185212, 31191817, 31221150, 31491449, 31578575, 31705019, 31709531, 9759898		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	25839768		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27576490, 9725792		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29772059		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	25623966		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	11161609	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	26585233, 28380429		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	22048272		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	15894599		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	17721998		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27639593		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28054838, 28521301, 31333800		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17578888, 22228716, 23894433, 24895488, 34573427	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18426815, 19893003, 29763838, 31270932		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23857381	Inhibit	★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	20127724		★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Optic Nerve Glioma	BEFREE	26585233		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	10337033	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11352237, 20862675	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21336628	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 6	Osteogenesis imperfecta	Pubtator	16524739	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36755691	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22506069, 40374042	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25330803, 28901496		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24364468, 26983899		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25712684, 29170526, 31991061, 33721368, 35012533, 36766725, 37264954	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28868628	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxalosis	Hyperoxaluria	CTD_human_DG	16284884		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10881930, 16614115, 22205974, 29358632		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27991933		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19874825	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29358632	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	16614115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23957698		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15488313		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18678243		★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	31559531	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31559531		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	11472436, 37510279	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25119558		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	32835907	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	19846984	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34360900	Inhibit	★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	BEFREE	26906062, 27836178		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34119324	Stimulate	★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	25691409		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	12126966		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16161154, 19099590, 23362217, 23792449, 23876400, 29288523, 30200999, 31018021, 31173214		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28216616	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16161154		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19099590, 19242540, 29288523, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19242540		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	16555943	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	10086850, 34122426	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11344355, 17647003, 27859608, 28472186		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27859608		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11850348, 24993099		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33816621	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16029496, 18727632, 19153534, 23267209, 23384071, 26965295, 29535517, 34588774	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19229703, 27199554	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	18385174		★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	30854716		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11884483		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	12449175	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17620002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17620002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	19729668	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyelonephritis	Pyelonephritis	BEFREE	17228365		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614, 25501066	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	26304916		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	15122808		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	23181789, 26304916	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	37563071	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21063127		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	7689610		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10229398, 10337033, 10881738, 10895380, 12176812, 15331395, 15971427, 16564576, 17328045, 19126414, 22401175, 22750227, 25607251, 27988812, 28165872, 28619088, 29093715, 29998825, 30431436, 31011897, 31037071, 31152257, 7521808, 7545093, 7680648		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15971427, 16489254		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	LHGDN	15064621		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	Pubtator	8977128	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	9032215		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	17982926, 19153534, 20459697, 27667736	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	10988120, 11803051, 11844139, 12449175, 16855620, 9533940		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	12449175, 9192918	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	25004830	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	12449175	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	37075652	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28968684		★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	18432520	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	12126966		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30411783, 30554073		★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	22048272		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	35184762	Associate	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	15860669, 17540042		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	9420304	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	16914566		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	9532637, 9761019		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	10364494		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848, 34386009, 35720379	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31086200	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12603855	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	1380064, 28954264	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	15591815, 27068801, 28954264		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	34768877	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	20847078	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	39516747	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26406376, 29208683		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26317795, 29705397, 31773415		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20622890, 25271422, 34697152	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20702412	Stimulate	★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	24934326		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	31409556		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27639593, 29760499, 29956205		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19846984, 24323564, 29772686		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	32630408	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18306985		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19846984, 21284875, 24323564, 24396281, 35261108	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17183455	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	21936853, 22537155		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	24903614	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	LHGDN	15482330		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	25724256	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	10966058, 17599774, 28968684, 29529897		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28778711		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	LHGDN	15482330		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	32425934	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	22955940	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	27832278		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23957698, 35515000, 36266640	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	LHGDN	18415893		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	29498364	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27245471, 32604892	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26752006, 27027351, 29559701, 31105691, 35377948, 37342906	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27027351, 28899878, 29559701, 29693154, 29898755, 30111819		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35268073	Stimulate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	36111504	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16565224, 30147719		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11904733, 39231199	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30310111, 34893045	Associate	★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	Pubtator	36539847	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31121496	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39901166	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	32957329	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	14651522		★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	17417600	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	30365067		★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	19729323	Associate	★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	24741602	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	15572394, 31468124		★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	24741602	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	20869067		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	28132854, 29115683		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	28132854, 29115683		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	21921047	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CCL3 3 shared diseasesGlomerulonephritis, Mesothelioma, Pulmonary fibrosis 10 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway, Chagas disease, Human cytomegalovirus infection, Rheumatoid arthritis, Lipid and atherosclerosis, Chemokine receptors bind chemokines, Interleukin-10 signaling 5 shared evidence sourcesDisgenet (Glomerulonephritis), CTD (Glomerulonephritis), CTD (Mesothelioma), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 10 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor — evidence mostly CTD. IL12B 5 shared diseasesBiliary cirrhosis, Liver cirrhosis, Mesothelioma, Biliary cholangitis, Pulmonary fibrosis 7 shared pathwaysCytokine-cytokine receptor interaction, Toll-like receptor signaling pathway, Chagas disease, Influenza A, Herpes simplex virus 1 infection, Lipid and atherosclerosis, Interleukin-10 signaling 7 shared evidence sourcesDisgenet (Asthma), Disgenet (Biliary cirrhosis), CTD (Liver cirrhosis), CTD (Mesothelioma), Disgenet (Biliary cholangitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 7 shared pathways including Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway — evidence mostly Disgenet. CXCL10 4 shared diseasesBiliary cirrhosis, Liver cirrhosis, Atopic dermatitis, Biliary cholangitis 10 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway, Cytosolic DNA-sensing pathway, TNF signaling pathway, Influenza A, G alpha (i) signalling events, Chemokine receptors bind chemokines, Interleukin-10 signaling 5 shared evidence sourcesDisgenet (Biliary cirrhosis), CTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Liver cirrhosis), Disgenet (Biliary cholangitis) Related via 10 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor — evidence mostly Disgenet. CXCL9 4 shared diseasesBiliary cirrhosis, Liver cirrhosis, Mesothelioma, Biliary cholangitis 6 shared pathwaysCytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway, G alpha (i) signalling events, Chemokine receptors bind chemokines 4 shared evidence sourcesDisgenet (Biliary cirrhosis), CTD (Liver cirrhosis), CTD (Mesothelioma), Disgenet (Biliary cholangitis) Related via 6 shared pathways including Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor — evidence mostly Disgenet. IL5 3 shared diseasesAutoimmune hepatitis, Atopic dermatitis, Pulmonary fibrosis 1 shared pathwayCytokine-cytokine receptor interaction 8 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), Disgenet (Autoimmune hepatitis), CTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Autoimmune hepatitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 3 shared diseases including Autoimmune hepatitis, Atopic dermatitis — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CCL3	3	["Glomerulonephritis","Mesothelioma","Pulmonary fibrosis"]	10	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","Chemokine signaling pathway","Toll-like receptor signaling pathway","Chagas disease","Human cytomegalovirus infection","Rheumatoid arthritis","Lipid and atherosclerosis","Chemokine receptors bind chemokines","Interleukin-10 signaling"]	5	["Disgenet (Glomerulonephritis)","CTD (Glomerulonephritis)","CTD (Mesothelioma)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
IL12B	5	["Biliary cirrhosis","Liver cirrhosis","Mesothelioma","Biliary cholangitis","Pulmonary fibrosis"]	7	["Cytokine-cytokine receptor interaction","Toll-like receptor signaling pathway","Chagas disease","Influenza A","Herpes simplex virus 1 infection","Lipid and atherosclerosis","Interleukin-10 signaling"]	7	["Disgenet (Asthma)","Disgenet (Biliary cirrhosis)","CTD (Liver cirrhosis)","CTD (Mesothelioma)","Disgenet (Biliary cholangitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
CXCL10	4	["Biliary cirrhosis","Liver cirrhosis","Atopic dermatitis","Biliary cholangitis"]	10	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","Chemokine signaling pathway","Toll-like receptor signaling pathway","Cytosolic DNA-sensing pathway","TNF signaling pathway","Influenza A","G alpha (i) signalling events","Chemokine receptors bind chemokines","Interleukin-10 signaling"]	5	["Disgenet (Biliary cirrhosis)","CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Liver cirrhosis)","Disgenet (Biliary cholangitis)"]
CXCL9	4	["Biliary cirrhosis","Liver cirrhosis","Mesothelioma","Biliary cholangitis"]	6	["Cytokine-cytokine receptor interaction","Viral protein interaction with cytokine and cytokine receptor","Chemokine signaling pathway","Toll-like receptor signaling pathway","G alpha (i) signalling events","Chemokine receptors bind chemokines"]	4	["Disgenet (Biliary cirrhosis)","CTD (Liver cirrhosis)","CTD (Mesothelioma)","Disgenet (Biliary cholangitis)"]
IL5	3	["Autoimmune hepatitis","Atopic dermatitis","Pulmonary fibrosis"]	1	["Cytokine-cytokine receptor interaction"]	8	["Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Autoimmune hepatitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]

Diseases Linked via Similar Genes

Brain ischemia Linked via 2 of 5 related genesCCL3, CXCL10 Colonic neoplasms Linked via 2 of 5 related genesCCL3, CXCL10 Hypersensitivity Linked via 2 of 5 related genesCCL3, CXCL9 Myocardial ischemia Linked via 2 of 5 related genesCCL3, CXCL10 Celiac disease Linked via 2 of 5 related genesCXCL10, CXCL9

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Brain ischemia	2	["CCL3","CXCL10"]
Colonic neoplasms	2	["CCL3","CXCL10"]
Hypersensitivity	2	["CCL3","CXCL9"]
Myocardial ischemia	2	["CCL3","CXCL10"]
Celiac disease	2	["CXCL10","CXCL9"]