IL5 (interleukin 5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3567
• Gene name: Interleukin 5
• Gene symbol: IL5
• Synonyms (NCBI Gene): EDF, IL-5, TRF
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased producti

miRNA Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017691	hsa-miR-335-5p	Microarray	18185580
MIRT039253	hsa-miR-454-5p	CLASH	23622248
MIRT719916	hsa-miR-3662	HITS-CLIP	19536157
MIRT719915	hsa-miR-8063	HITS-CLIP	19536157
MIRT719914	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT719913	hsa-miR-1248	HITS-CLIP	19536157
MIRT719912	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT719911	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT719910	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT719909	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT719908	hsa-miR-4279	HITS-CLIP	19536157
MIRT513556	hsa-miR-4772-3p	PAR-CLIP	23446348
MIRT513555	hsa-miR-9-5p	PAR-CLIP	23446348
MIRT513554	hsa-miR-604	PAR-CLIP	23446348
MIRT513553	hsa-miR-6762-3p	PAR-CLIP	23446348
MIRT513552	hsa-miR-647	PAR-CLIP	23446348
MIRT513550	hsa-miR-6842-3p	PAR-CLIP	23446348
MIRT513556	hsa-miR-4772-3p	PAR-CLIP	27292025
MIRT513556	hsa-miR-4772-3p	PAR-CLIP	27292025
MIRT513554	hsa-miR-604	PAR-CLIP	27292025
MIRT513554	hsa-miR-604	PAR-CLIP	27292025
MIRT513552	hsa-miR-647	PAR-CLIP	27292025
MIRT513552	hsa-miR-647	PAR-CLIP	27292025
MIRT513553	hsa-miR-6762-3p	PAR-CLIP	27292025
MIRT513553	hsa-miR-6762-3p	PAR-CLIP	27292025
MIRT513550	hsa-miR-6842-3p	PAR-CLIP	27292025
MIRT513550	hsa-miR-6842-3p	PAR-CLIP	27292025
MIRT513555	hsa-miR-9-5p	PAR-CLIP	27292025
MIRT513555	hsa-miR-9-5p	PAR-CLIP	27292025
MIRT719916	hsa-miR-3662	HITS-CLIP	19536157
MIRT719915	hsa-miR-8063	HITS-CLIP	19536157
MIRT719914	hsa-miR-1237-3p	HITS-CLIP	19536157
MIRT719913	hsa-miR-1248	HITS-CLIP	19536157
MIRT719912	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT719911	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT719910	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT719909	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT719908	hsa-miR-4279	HITS-CLIP	19536157
MIRT513556	hsa-miR-4772-3p	PAR-CLIP	23446348
MIRT513555	hsa-miR-9-5p	PAR-CLIP	23446348
MIRT513554	hsa-miR-604	PAR-CLIP	23446348
MIRT513553	hsa-miR-6762-3p	PAR-CLIP	23446348
MIRT513552	hsa-miR-647	PAR-CLIP	23446348
MIRT513550	hsa-miR-6842-3p	PAR-CLIP	23446348
MIRT1064995	hsa-miR-4796-5p	CLIP-seq
MIRT2247760	hsa-miR-1229	CLIP-seq
MIRT2247761	hsa-miR-4418	CLIP-seq
MIRT2247762	hsa-miR-509-3-5p	CLIP-seq
MIRT2247763	hsa-miR-509-5p	CLIP-seq

Transcription factors Show/Hide all (18)

Transcription factor	Regulation	Reference
CEBPA	Unknown	10453008
CEBPB	Unknown	10453008
EP300	Unknown	16922677
ETS1	Activation	10212281
ETS2	Activation	10212281;19487701
FOSL2	Unknown	10491186
GATA3	Activation	10212281
GATA3	Unknown	16498264;17270283;20522714
GATA4	Activation	7791790;9209438
HDAC4	Unknown	16922677
JUND	Unknown	10491186
MAF	Unknown	16498264
POU2F1	Unknown	10491186
POU2F2	Unknown	10491186
SATB1	Repression	20522714
SPI1	Activation	19487701
YY1	Activation	10518827
YY1	Unknown	17270283

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	33099778
GO:0005125	Function	Cytokine activity	IEA
GO:0005137	Function	Interleukin-5 receptor binding	IEA
GO:0005137	Function	Interleukin-5 receptor binding	TAS	3024129
GO:0005515	Function	Protein binding	IPI	1495999, 22153509
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	33099778
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	3024129
GO:0006954	Process	Inflammatory response	TAS	3498940
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0030222	Process	Eosinophil differentiation	IDA	11823534
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IBA
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	1495999, 7613138, 11823534, 22528658
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	33099778
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IEA
GO:0045645	Process	Positive regulation of eosinophil differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0071803	Process	Positive regulation of podosome assembly	IDA	15220135

Other IDs

• MIM: 147850
• HGNC: 6016
• e!Ensembl: ENSG00000113525

Protein

• UniProt ID: P05113
• Protein name: Interleukin-5 (IL-5) (B-cell differentiation factor I) (Eosinophil differentiation factor) (T-cell replacing factor) (TRF)
• Protein function: Homodimeric cytokine expressed predominantly by T-lymphocytes and NK cells that plays an important role in the survival, differentiation, and chemotaxis of eosinophils (PubMed:2653458, PubMed:9010276). Also acts on activated and resting B-cells
• PDB: 1HUL , 3QT2 , 3VA2 , 8TLD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02025	IL5	22 → 133	Interleukin 5	Domain

• Tissue specificity: TISSUE SPECIFICITY: Present in peripheral blood mononuclear cells. {ECO:0000269|PubMed:32211550}.
• Sequence:

  MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
  QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
  EFLGVMNTEWIIES

• Sequence length: 134

Pathways

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Interleukin-3, Interleukin-5 and GM-CSF signaling
JAK-STAT signaling pathway	RAF/MAP kinase cascade
Hematopoietic cell lineage	Interleukin receptor SHC signaling
IL-17 signaling pathway
Th1 and Th2 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Intestinal immune network for IgA production
Pathways in cancer
Asthma
Autoimmune thyroid disease
Inflammatory bowel disease
Allograft rejection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASTHMA	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	23266719, 7540862, 30552067, 31361310, 31619474, 31669095, 32514122	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	16360218	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE CHRONIC HEPATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE HEPATITIS WITH CENTRILOBULAR NECROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ALLERGIC CONTACT	—	CTD, Disgenet CTD, Disgenet	15347381	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	11886533, 18249437, 33274957	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	CTD, Disgenet CTD, Disgenet	11006010, 1988543	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, AUTOIMMUNE	—	CTD	21227906	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	17620002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (341)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	3258537		★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	2397611		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	8049355		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	9414269		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	7519825		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	11877300		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	20660789		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	9234684		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	11737045, 12215387, 16942566, 17459468, 22186238, 22487280, 23800473, 24717944, 27216347, 28214951, 30554982, 30694585, 30980570, 31096432, 31267527, 7613132, 8398174, 9078933, 9802369		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	18849614, 23579771		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17620002		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17992457, 30193587	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease type 2	Alzheimer disease	Pubtator	11579103	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31164999		★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	2783863	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	33776989	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22033263		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	29100307		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	31772507		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	33776989	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18268038, 31337962		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22035391	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34944509	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22355377	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10212281, 10491186, 10651947, 10770817, 10939534, 11413353, 11567984, 11724761, 11745390, 12871219, 1493921, 1530827, 18322230, 19483109, 2022726, 20522714, 21179211, 21985360, 22528658, 23121677, 23956426, 24075231, 25390970, 25543042, 26061524, 26344080, 26466682, 28000949, 28199345, 28231834, 28373098, 30361247, 31175163, 31391224, 33626956, 33774455, 33808110, 34144111, 35579040, 36497064, 36682083, 37865742, 38253462, 7523534, 7807013, 9176543, 9312165	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	10227331, 10336593, 10383594, 10487780, 10529584, 10640772, 10651947, 10835320, 10867512, 10975869, 11155664, 11292021, 11306982, 11359860, 11724761, 11826234, 12045241, 12125504, 12231502, 12444154, 12444155, 12534456, 12618746, 12642837, 12771545, 12847481, 12874248, 1401075, 14619337, 15474864, 15764907, 15805995, 15947486, 16498264, 17362254, 17581195, 17884733, 18004073, 18849614, 19151322, 19198019, 19401034, 19548628, 20157138, 2022726, 20709516, 20861642, 21150622, 21276008, 21841801, 21986312, 22186238, 23728885, 23957336, 24679467, 25120738, 25704963, 25715236, 25769613, 26065426, 27050946, 27373855, 27696462, 27773786, 27859832, 28035475, 28070196, 28093225, 28168862, 28266165, 28287273, 28364396, 28373098, 28378503, 28574721, 28622052, 28628664, 28658556, 28686637, 28703634, 28913336, 28933516, 29108648, 29122156, 29132961, 29257776, 29269115, 29359607, 29427987, 29449864, 29483774, 29486600, 29535264, 29676620, 29680938, 29682504, 29694255, 29694974, 29713354, 29718738, 29780238, 29862274, 29888398, 29890236, 29894793, 29909018, 29921484, 29972739, 29992472, 30005648, 30041726, 30105031, 30115042, 30192638, 30199847, 30201478, 30217529, 30275843, 30290688, 30309978, 30323811, 30359762, 30405579, 30407206, 30416896, 30424940, 30453868, 30496803, 30498762, 30519580, 30525902, 30536454, 30597278, 30619345, 30707957, 30816463, 30834543, 30940770, 30972065, 31009582, 31017107, 31076057, 31145343, 31175163, 31346991, 31389304, 31415658, 31502421, 31645649, 31673233, 31703832, 31734469, 31776937, 31821769, 7523534, 7540862, 7613132, 7742012, 7742019, 7812887, 8006305, 8083466, 8360390, 8417755, 8564096, 8648029, 8755934, 8998072, 9105087, 9120316, 9440546, 9450903, 9525446, 9801738, 9949314		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12575459, 12910312, 12915771, 16001979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	16449261, 27918476, 28752719	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	23266719, 7540862		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	30552067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	18268038, 31337962		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25587992, 36682083	Inhibit	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32785591	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26799787, 31165277		★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	19509467	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	28648630		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	38288647	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29343961, 29571898, 31228728		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	16360218		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	29343961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	CTD_human_DG	21227906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	26693492, 7806143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29163523, 29671873		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	39201794, 8988234	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	30356853		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	1765644, 20952689		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18925696		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17301820		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23770289		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26621531, 30018709, 31428522		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20418110, 26621531, 30814616	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37910571	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	11826234, 11897983, 23706710, 29890236, 8624254		★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial hyperreactivity	Pubtator	16449261	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	12847481, 30290688		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	33514798	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	9176543	Associate	★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	BEFREE	11435248, 11751191, 17322111		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	12413767, 12558956, 28135772, 30042946		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	8450029	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23770289		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31024531		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24768357	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	19608731		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28302646		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26821299		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26821299, 36682083	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	25587992	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	20943047, 32469969	Associate	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Castleman disease	Pubtator	36593046	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	1730922, 7523534		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	7523534	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26821299, 39675594	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	21179211		★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	17914408, 19728396, 20523072, 29029406, 9625582		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17301820		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11440642, 28893134, 29483774, 29609004, 29626211, 30278779, 30570418, 30977152, 31073084, 31076058, 31190789, 31346991		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	11023273		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	19379606, 24504744, 25704963, 26625351, 28035475, 28122135, 29785413, 29802623, 30296011, 30974106, 31727332		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	18375080, 23489830, 25692703, 9560101		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866	Associate	★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	19643727		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30319608, 30930900		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	28132889	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	9779259	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	9779259	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	2397611		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	1715959		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21418620		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26821299, 31495774		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21966275, 25587992, 26821299, 36760349, 39675594	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26821299, 31495774		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26821299, 31495774		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	22927709	Associate	★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	34719421	Stimulate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	27959637, 29249187, 29883053, 31600458		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	9218830	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23349929, 7557575	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28132889	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28132889, 9161954		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	27757545		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29142423, 29998825, 9032818		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	25112708		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	2263604	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23609520, 30524320		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	12443893, 21437440, 28615416, 8040343		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	10504452, 33274957	Inhibit	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	10620139, 10939534, 11886533, 19116453, 23983609, 26682905, 30685456, 35182548, 7523534, 8040343, 8800302, 9496691	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	16804630	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	CTD_human_DG	15347381		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	11886533, 18249437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	11886533, 14581138, 15035853, 15948978, 17008059, 17620072, 18234309, 18363757, 26475182, 27289147, 27639070, 30154801, 7523534, 8040343, 9164367, 9199877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	14581138		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	30405579		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26067893	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30518692		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17666463, 28236320, 30442459, 31355294, 31704479		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29194733	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31355294	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28236320, 31355294		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30227886	Associate	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	31830482		★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	25365709		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	29283120, 35562919	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31673224		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	21203348	Stimulate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	11886533, 14581138, 15035853, 15948978, 17008059, 17620072, 18234309, 26475182, 27289147, 27639070, 30154801, 31783259, 7523534, 8040343, 9164367, 9199877		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	11886533, 18249437		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	BEFREE	17332188		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	26166120	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27409342		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27409342, 33690729	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	27624222, 28057433	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	23472217	Inhibit	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	10086726, 11122208, 11159044, 11159534, 11290768, 11292020, 11292021, 11313423, 11477111, 11714825, 11897983, 12045241, 12077275, 12125504, 12231502, 12499902, 12759459, 1334944, 14581138, 15474864, 15728513, 16720555, 1730922, 17399779, 17581195, 17845581, 17913447, 17914408, 18166354, 1912580, 19860791, 20802177, 21276008, 2156579, 23181791, 23689305, 2403816, 24968337, 25981191, 26039722, 26076339, 26276876, 27624222, 28116937, 28226398, 28530840, 28541554, 28615416, 28862877, 28921511, 28948572, 28993458, 29018800, 29163523, 29337425, 29500225, 29573413, 29859068, 29862274, 30543818, 30589094, 30779114, 30834543, 30930900, 31404668, 31415658, 31624262, 31690395, 31769882, 31821769, 7560666, 7576704, 7577627, 7718877, 7835952, 8092143, 8100845, 8335853, 8425573, 8475567, 8485042, 8493995, 8602991, 8784786, 8818342, 8922493, 9407718, 9463570, 9516119, 9525446, 9680139, 9779259, 9802369, 9949310		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	Pubtator	10491186, 10511609, 10998137, 11567984, 11579103, 11745390, 12354764, 15070668, 15609294, 16446960, 17166416, 1730922, 18322230, 18410960, 1864012, 1912580, 19478474, 20522714, 21211656, 22830543, 26047816, 2787385, 28226398, 32849632, 3498940, 8608231, 9779259, 9798664	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	CTD_human_DG	11006010, 1988543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	LHGDN	14581138, 17581195, 18395252		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia, Tropical	Eosinophilia	CTD_human_DG	11006010, 1988543		★☆☆☆☆ Found in Text Mining only
Eosinophilia, Tropical	Eosinophilia	BEFREE	28875265		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	17412401, 18166354, 25112708, 25801352, 26039722, 26258919, 28428721, 28831387, 29234969, 29372536, 31175521, 31690395		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21211656, 21921589, 26258919, 30455683, 32197970	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic myositis (disorder)	Eosinophilic Myositis	BEFREE	12534990		★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	39259090	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25613757, 9673357		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25613757	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25613757, 9673357		★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	7963654		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	39234251	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	32043817	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30049387		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30049387		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	7908616, 8565271	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	16596275		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	32009195, 33750029	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20332709, 21235536		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	21235536	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	30356853, 30819087		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	7523534	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21418620	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	39675594	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	2783863	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	8706330	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10377189, 1632458	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10377189, 1532136, 20660789, 2403816, 8493995, 9407718		★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	1493476, 15772698, 15905537, 16612767, 16781488, 24627079, 31146595, 7864028, 8562393, 8608231		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	10511609, 10886202, 11724761, 12871219, 15070668, 18410960, 2787385, 35752781, 39788434, 7835952, 8608231	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	15474864, 18344568, 28986919, 8425573, 8608231		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	16761316, 20810155, 23987798	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	33690729	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	11511310	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	40024310	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	25550791	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	15474864, 17417985, 18344568, 19243381, 19728396, 20523072, 21761433, 24577808, 26486351, 28986919, 29173361, 29680938, 29751154, 31657082, 7835952, 8425573, 8608231		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10515397, 7664490, 9150314	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	7908616, 7965399		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	10227331		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	LHGDN	14564341		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	14670926		★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	20012054, 9609136		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	11114129		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11101567	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31567972		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	21437440, 28615416, 8040343		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	10359103		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26821299		★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann syndrome	Pubtator	33629532	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	22413749	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Seborrheic	Seborrheic keratosis	Pubtator	8450029	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	29100307, 8922493		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	20561085	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	1688504, 9326348	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1715959, 19036083		★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2242429	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	2070072, 2783863, 9326348	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1688504, 9414269	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	2783863	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1688504, 1715959, 7577627, 8558916, 9694696, 9792291		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	9234684		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28807497		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21735469	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	29921484, 8676086		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	9039167		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21437440, 23125486, 27412348, 33882880	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21437440		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	24616476		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1334944, 1493476, 19243381		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	18925696		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20952689		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	11453809, 11807001, 16428475, 7963654		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	11745390, 8608231	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	8608231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26621531, 30018709, 31428522		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27409342		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25613757, 9673357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31024531		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20403914, 27500645		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23770289		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29486600		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	20523072		★☆☆☆☆ Found in Text Mining only
Mediastinal Neoplasms	Mediastinal Neoplasms	BEFREE	16720555		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19240164	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24463459	Inhibit	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23609520, 30524320		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	7557575	Associate	★☆☆☆☆ Found in Text Mining only
Mullerian Aplasia and Hyperandrogenism	Mullerian Aplasia And Hyperandrogenism	BEFREE	31175162		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18172012		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	11238569, 14568126, 17015755, 31731047		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	11238569, 16412061, 39201794	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	2403822		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	3258537		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9118038		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22449623		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	12534990		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	16446960, 19639723, 24911279, 24947894, 27166273, 28474861, 29768034, 30375439, 35747690, 36211987, 37898408	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	18802357, 19170670, 19639723, 25692703, 25704963, 26987817, 28494786, 28918644, 29746583, 29802623, 30519393, 31073812, 9761019		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26067893, 28494786, 31928947, 33287173, 35752781	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28207826	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28207826		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	9463570		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	19608731		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12885350, 17301820, 17518371, 20003451, 22108090, 30073695, 31555258, 7773153, 7963654, 8917716		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	7965399		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	36593046	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	8640845	Associate	★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	30524320		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	1912580, 24968337, 28008659		★☆☆☆☆ Found in Text Mining only
Nicolaides Baraitser syndrome	Nicolaides Baraitser Syndrome	BEFREE	11448772		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	11448772		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31639326		★☆☆☆☆ Found in Text Mining only
Omenn Syndrome	Omenn Syndrome	BEFREE	8287598, 9258771		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21418620	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31898441	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	31898441	Associate	★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	27633913		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	16238798, 31515081		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37322531	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28935682		★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	28489854	Associate	★☆☆☆☆ Found in Text Mining only
Parapsoriasis	Parapsoriasis	Pubtator	7963654	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24593806, 38231411	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	35921900	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	BEFREE	12366695, 12558956		★☆☆☆☆ Found in Text Mining only
Pemphigoid, Benign Mucous Membrane	Mucous membrane pemphigoid	LHGDN	12366695		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	11161984		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	16946717, 31211854	Associate	★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	28546236		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28861078		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	9010272	Stimulate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	12519389	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	11877300		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	8100745		★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	28875265, 30444149		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	10634216, 17518371, 7806143		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20403914, 27500645		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23754304, 32999046	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	10634216		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34816685	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	10706504, 8676086, 9694696		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19478474, 28979110, 29859068, 31320835, 39766355	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	10559323, 15905537, 21150622, 22634619, 23093652, 27889561, 28159511, 28344579, 28395936, 28570692, 28737051, 28875265, 28933516, 29059618, 29122156, 29133975, 29157020, 29554826, 29606855, 29637936, 29729941, 29862274, 30021546, 30192638, 30217438, 30354852, 30407206, 30498762, 30854716, 30906226, 30961951, 31009582, 31017107, 31145343, 31175163, 31201938, 31395084, 31414917, 31479312, 31606052, 8784786		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17620002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17620002		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	28518224		★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	28518224	Associate	★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	2783863		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	30407207		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	9694696		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	30407207		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24718616, 30193587	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31704479		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	21063127		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	20408969		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10733472, 30341437, 8778953, 9032818		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	11122208, 1560199, 7819742, 8398174		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33626956, 37091906	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	10652165	Associate	★☆☆☆☆ Found in Text Mining only
Rhinitis, Allergic, Perennial	Rhinitis	BEFREE	8630617, 9078933		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	18000138, 28875265		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	23384655	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	23384655	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10366109	Associate	★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	2397611, 9609136		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29672927, 30547887		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	8287598, 8506326	Associate	★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	24071371		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	10491012, 11453809		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	7923918	Associate	★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	8755934		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	17040605, 9761019		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	21437440	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	8040343	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Diseases Vascular	Skin disease	Pubtator	1997656	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16428475, 17620072, 27289147, 27623398, 30154801, 30544712, 31106757, 31783259, 8040343		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	7519825		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25613757		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	31495774		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10333716, 18687755	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24741632	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36315566	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	28518224, 8755934		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	8755934		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	20012054		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11453809, 16612767, 20952689, 8485042, 8493995		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	18395252		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	12970294, 20332709		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	15935984		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15935984, 28132889, 29226079, 30638678, 31643033, 9779259		★☆☆☆☆ Found in Text Mining only
Ureteral Calculi	Ureteral calculi	Pubtator	30484290	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22962576	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Overactive	Overactive bladder	Pubtator	32080289	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	30484290	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19369479	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Uveitis	Pubtator	14977779	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	33314028	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30201478		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36797040	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

IL4 4 shared diseasesAutoimmune hepatitis, Allergic contact dermatitis, Atopic dermatitis, Pulmonary fibrosis 12 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Hematopoietic cell lineage, IL-17 signaling pathway, Th1 and Th2 cell differentiation, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, Intestinal immune network for IgA production, Asthma, Autoimmune thyroid disease, Inflammatory bowel disease, Allograft rejection 10 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), Disgenet (Autoimmune hepatitis), CTD (Allergic contact dermatitis), Disgenet (Allergic contact dermatitis), CTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Autoimmune hepatitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 12 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway — evidence mostly Disgenet. CCL11 2 shared diseasesAtopic dermatitis, Pulmonary fibrosis 3 shared pathwaysCytokine-cytokine receptor interaction, IL-17 signaling pathway, Asthma 6 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), CTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 3 shared pathways including Cytokine-cytokine receptor interaction, IL-17 signaling pathway — evidence mostly Disgenet. IL13 3 shared diseasesAutoimmune hepatitis, Atopic dermatitis, Pulmonary fibrosis 7 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Fc epsilon RI signaling pathway, Asthma, Inflammatory bowel disease 8 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), Disgenet (Autoimmune hepatitis), CTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Autoimmune hepatitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 7 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway — evidence mostly Disgenet. STAT6 3 shared diseasesAtopic dermatitis, Eosinophilia, Pulmonary fibrosis 3 shared pathwaysJAK-STAT signaling pathway, Th1 and Th2 cell differentiation, Inflammatory bowel disease 4 shared evidence sourcesCTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 3 shared diseases including Atopic dermatitis, Eosinophilia — evidence mostly CTD. CCL5 3 shared diseasesAutoimmune hepatitis, Atopic dermatitis, Pulmonary fibrosis 1 shared pathwayCytokine-cytokine receptor interaction 8 shared evidence sourcesDisgenet (Asthma), CTD (Asthma), Disgenet (Autoimmune hepatitis), CTD (Atopic dermatitis), Disgenet (Atopic dermatitis), CTD (Autoimmune hepatitis), CTD (Pulmonary fibrosis), Disgenet (Pulmonary fibrosis) Related via 3 shared diseases including Autoimmune hepatitis, Atopic dermatitis — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
IL4	4	["Autoimmune hepatitis","Allergic contact dermatitis","Atopic dermatitis","Pulmonary fibrosis"]	12	["Cytokine-cytokine receptor interaction","JAK-STAT signaling pathway","Hematopoietic cell lineage","IL-17 signaling pathway","Th1 and Th2 cell differentiation","T cell receptor signaling pathway","Fc epsilon RI signaling pathway","Intestinal immune network for IgA production","Asthma","Autoimmune thyroid disease","Inflammatory bowel disease","Allograft rejection"]	10	["Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","CTD (Allergic contact dermatitis)","Disgenet (Allergic contact dermatitis)","CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Autoimmune hepatitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
CCL11	2	["Atopic dermatitis","Pulmonary fibrosis"]	3	["Cytokine-cytokine receptor interaction","IL-17 signaling pathway","Asthma"]	6	["Disgenet (Asthma)","CTD (Asthma)","CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
IL13	3	["Autoimmune hepatitis","Atopic dermatitis","Pulmonary fibrosis"]	7	["Cytokine-cytokine receptor interaction","JAK-STAT signaling pathway","IL-17 signaling pathway","Th1 and Th2 cell differentiation","Fc epsilon RI signaling pathway","Asthma","Inflammatory bowel disease"]	8	["Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Autoimmune hepatitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
STAT6	3	["Atopic dermatitis","Eosinophilia","Pulmonary fibrosis"]	3	["JAK-STAT signaling pathway","Th1 and Th2 cell differentiation","Inflammatory bowel disease"]	4	["CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]
CCL5	3	["Autoimmune hepatitis","Atopic dermatitis","Pulmonary fibrosis"]	1	["Cytokine-cytokine receptor interaction"]	8	["Disgenet (Asthma)","CTD (Asthma)","Disgenet (Autoimmune hepatitis)","CTD (Atopic dermatitis)","Disgenet (Atopic dermatitis)","CTD (Autoimmune hepatitis)","CTD (Pulmonary fibrosis)","Disgenet (Pulmonary fibrosis)"]

Diseases Linked via Similar Genes

Eczema Linked via 3 of 5 related genesIL4, IL13, STAT6 Hypersensitivity Linked via 3 of 5 related genesIL4, CCL11, IL13 Rhinitis Linked via 2 of 5 related genesIL4, IL13 Dermatitis Linked via 2 of 5 related genesIL4, IL13 Graves disease Linked via 2 of 5 related genesIL4, IL13

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Eczema	3	["IL4","IL13","STAT6"]
Hypersensitivity	3	["IL4","CCL11","IL13"]
Rhinitis	2	["IL4","IL13"]
Dermatitis	2	["IL4","IL13"]
Graves disease	2	["IL4","IL13"]