IL12B (interleukin 12B)

Gene

• Entrez ID: 3593
• Gene name: Interleukin 12B
• Gene symbol: IL12B
• Synonyms (NCBI Gene): CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encode

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT715156	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT715155	hsa-miR-4705	HITS-CLIP	19536157
MIRT715154	hsa-miR-103b	HITS-CLIP	19536157
MIRT715153	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT715152	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT715151	hsa-miR-4284	HITS-CLIP	19536157
MIRT734760	hsa-miR-34a-3p	Microarray, qRT-PCR	33713393
MIRT715156	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT715155	hsa-miR-4705	HITS-CLIP	19536157
MIRT715154	hsa-miR-103b	HITS-CLIP	19536157
MIRT715153	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT715152	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT715151	hsa-miR-4284	HITS-CLIP	19536157
MIRT1063608	hsa-miR-1207-3p	CLIP-seq
MIRT1063609	hsa-miR-3649	CLIP-seq
MIRT1063610	hsa-miR-3675-3p	CLIP-seq
MIRT1063611	hsa-miR-4716-5p	CLIP-seq
MIRT1063612	hsa-miR-587	CLIP-seq
MIRT2015022	hsa-miR-129-5p	CLIP-seq
MIRT2015023	hsa-miR-1915	CLIP-seq
MIRT2015024	hsa-miR-193a-5p	CLIP-seq
MIRT2015025	hsa-miR-3674	CLIP-seq
MIRT2015026	hsa-miR-4307	CLIP-seq
MIRT2015027	hsa-miR-4436b-5p	CLIP-seq
MIRT2015028	hsa-miR-4720-3p	CLIP-seq
MIRT2015029	hsa-miR-4726-3p	CLIP-seq
MIRT2015030	hsa-miR-4732-5p	CLIP-seq
MIRT2015031	hsa-miR-4804-3p	CLIP-seq
MIRT2015032	hsa-miR-483-5p	CLIP-seq
MIRT2015033	hsa-miR-889	CLIP-seq
MIRT2247354	hsa-miR-1200	CLIP-seq
MIRT2247355	hsa-miR-1343	CLIP-seq
MIRT2247356	hsa-miR-141	CLIP-seq
MIRT2247357	hsa-miR-192	CLIP-seq
MIRT2247358	hsa-miR-200a	CLIP-seq
MIRT2247359	hsa-miR-215	CLIP-seq
MIRT2247360	hsa-miR-219-5p	CLIP-seq
MIRT2247361	hsa-miR-335	CLIP-seq
MIRT2247362	hsa-miR-378g	CLIP-seq
MIRT2247363	hsa-miR-4437	CLIP-seq
MIRT2247364	hsa-miR-4445	CLIP-seq
MIRT2247365	hsa-miR-4674	CLIP-seq
MIRT2247366	hsa-miR-4774-5p	CLIP-seq
MIRT2247367	hsa-miR-4782-3p	CLIP-seq
MIRT2247368	hsa-miR-508-3p	CLIP-seq
MIRT2247369	hsa-miR-548a-3p	CLIP-seq
MIRT2247370	hsa-miR-548e	CLIP-seq
MIRT2247371	hsa-miR-548f	CLIP-seq
MIRT2451701	hsa-miR-1182	CLIP-seq
MIRT2451702	hsa-miR-4778-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Activation	15482860
ETS2	Unknown	10657616
IRF1	Unknown	10657616
JUN	Activation	14688340
KLF1	Unknown	14976188
NFKB1	Activation	14688340;18690006
NFKB1	Unknown	10657616
REL	Unknown	10657616
RELA	Activation	14688340;18690006
RELA	Unknown	10657616;15270850
SPI1	Unknown	11254706
VDR	Repression	21310195

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	TAS	1673147
GO:0001912	Process	Positive regulation of leukocyte mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002323	Process	Natural killer cell activation involved in immune response	IEA
GO:0002708	Process	Positive regulation of lymphocyte mediated immunity	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005125	Function	Cytokine activity	IDA	7584494
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005143	Function	Interleukin-12 receptor binding	IBA
GO:0005143	Function	Interleukin-12 receptor binding	TAS	9603733
GO:0005143	Function	Interleukin-12 receptor binding	TAS	1674604
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671, 11114383, 12023369, 18680750, 29997244
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	7584494
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	1673147
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	12023369
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008283	Process	Cell population proliferation	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IDA	7903063
GO:0030101	Process	Natural killer cell activation	IDA	1673147
GO:0031904	Component	Endosome lumen	IEA
GO:0031906	Component	Late endosome lumen	TAS
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	1674604, 11114383, 19088061, 20027291
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	TAS	1673147
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	15265908
GO:0032733	Process	Positive regulation of interleukin-10 production	TAS	18675459
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511, 16751425, 17888176
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16751425
GO:0032816	Process	Positive regulation of natural killer cell activation	IC	20027291
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IBA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775, 7638186, 8943050
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7584494
GO:0042088	Process	T-helper 1 type immune response	TAS	1673147
GO:0042093	Process	T-helper cell differentiation	IDA	1673147
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12023369
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	1674604, 11114383
GO:0042110	Process	T cell activation	IEA
GO:0042164	Function	Interleukin-12 alpha subunit binding	IBA
GO:0042164	Function	Interleukin-12 alpha subunit binding	IEA
GO:0042164	Function	Interleukin-12 alpha subunit binding	IPI	11023671
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	7527811
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0043514	Component	Interleukin-12 complex	IBA
GO:0043514	Component	Interleukin-12 complex	IDA	1674604, 11114383
GO:0043514	Component	Interleukin-12 complex	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045063	Process	T-helper 1 cell differentiation	IDA	14688310
GO:0045519	Function	Interleukin-23 receptor binding	IDA	11114383
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048599	Process	Oocyte development	TAS	16772281
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15114670, 20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IC	20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051607	Process	Defense response to virus	IEA
GO:0070743	Component	Interleukin-23 complex	IDA	11114383
GO:0070743	Component	Interleukin-23 complex	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	TAS	20428758
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

Other IDs

• MIM: 161561
• HGNC: 5970
• e!Ensembl: ENSG00000113302

Protein

• UniProt ID: P29460
• Protein name: Interleukin-12 subunit beta (IL-12B) (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)
• Protein function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. ; Assoc
• PDB: 1F42, 1F45, 3D85, 3D87, 3DUH, 3HMX, 3QWR, 4GRW, 5MJ3, 5MJ4, 5MXA, 5MZV, 5NJD, 6UIB, 6WDQ, 8CR8, 8OE4, 8XRP, 8YI7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10420	IL12p40_C	126 → 216	Cytokine interleukin-12p40 C-terminus	Domain

• Sequence:

  MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
  TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
  KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
  RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
  LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
  RKNASISVRAQDRYYSSSWSEWASVPCS

• Sequence length: 328

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
IL12B-related disorder	Likely pathogenic; Pathogenic	rs748215576	RCV003396354	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mendelian susceptibility to mycobacterial diseases due to complete IL12B deficiency	Pathogenic; Likely pathogenic	rs771036480, rs2113025865, rs786201006, rs1754121564, rs587776807, rs867933096, rs1380231411, rs1562113567, rs748215576, rs763190982, rs1290071275	RCV001783475 RCV001930198 RCV000162204 RCV003586641 RCV000015098 RCV003747830 RCV003748787 RCV000692446 RCV000779470 RCV001050613 RCV001246117	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive mendelian susceptibility to mycobacterial diseases due to a complete deficiency	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Atypical Mycobacteriosis, Autosomal Recessive	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 29	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inherited susceptibility to mycobacterial diseases	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
5q-syndrome	5q-syndrome	BEFREE	9339364, 9624537		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31142509		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31593700		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24529168		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	29566963		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	32359032	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	31142509		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	21767511, 31277552		★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	23408864	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	11704807, 19274925, 26663019		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	12193738		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26626881, 29070909, 30193587, 33206953	Associate	★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	26196693	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16926419, 21819616		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	17945537		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	20350312, 21819616	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	32411797	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	23285065, 29554212	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	23285065	Stimulate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	18082575, 21743469, 22045842, 24547735, 26103568, 26915668, 29200018, 30322951, 30443744, 30889422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	CTD_human_DG	21743469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30580570		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	34211061	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	26667304, 35095831, 8608632	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	18945879	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	21381000, 37543802	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	12841851, 16741508, 18369459, 18800148, 19035472, 20953186, 22298274, 27543964, 35297512, 36995469	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10233738, 10513808, 12223112, 12571841, 12632414, 15188356, 18369459, 22355377, 25469793, 26149185, 26956410, 27111665, 27896842, 32468016, 34369364, 8608632, 9410920	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27896842	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	19035472, 20084005, 20953186, 22532288, 23093722, 23252691, 23297015, 23673284, 24957500, 29389950, 30584776		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	LHGDN	19035472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	CTD_human_DG	20953186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthrogryposis	Arthrogryposis	Pubtator	30255293	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10860660, 11704807, 12241719, 15007350, 15322986, 16210052, 19274925, 21513752, 23575353, 24654313, 28287286, 28600552, 31187518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	12241719, 15356557		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15322986, 19274925, 20371397, 21103062, 21179211, 24654313, 32017227, 33515711, 33998076, 39380119	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	29515128	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	17100756	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15988104, 34292876, 35052452	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	36904292	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23353117	Stimulate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10513814, 18431321, 23830516, 24890729, 25966091	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15483662, 16966828, 18082575, 22194214, 22819329, 23830516, 24547735, 26915668, 27068848, 28276258		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	26113417	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	18192685		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10513814, 15654836, 15654837, 16514412, 16778812, 24859272, 27281077	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15248229, 36333776	Stimulate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16514412, 16778812, 18281862, 24859272, 25405820		★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	12449171	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	15128911	Associate	★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	20639880		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	20639880		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	35617338	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	9324294	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22011063		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34850166	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22702905		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18566447, 24568505	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22618884, 22702905, 24426833, 30814616, 36046784	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	16754651	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	10027419	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	22940148		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	33000216	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	14726965, 16718852, 19126646, 19194666, 26631030, 26783377, 29568203	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	31582519	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30396953		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27533245	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35836806	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	17644387		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	LHGDN	17644387		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32658258	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	32322161	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11972887, 14675396		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	14675396		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	15176994	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	18369459, 34449925	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28168424	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	18163209		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19118071, 19487916, 22614250		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19118071, 19487916, 22614250		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	17644387		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31142509		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	10860660, 12241719, 15175646, 15322986		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	25695689	Associate	★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	9339364	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	10523615, 32974878	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19279357, 22734699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	19210338		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21198766, 23592000	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22174866	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	22479607	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18438406, 22479607, 25761185, 26177303, 27281077, 31191543, 31206576, 32666631, 33730998	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30369485	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19832040, 23053983, 26104769, 29155516		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16101177, 17594499, 26104769, 32149085, 32209656	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17579859, 27494857	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	29710228	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	11966768, 14616794, 16634796, 19592080	Associate	★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	33511216	Associate	★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1L	Congenital disorder of glycosylation	Pubtator	29589181	Associate	★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	21749458		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15988104		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15988104		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	40303485	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15988104		★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	22342787	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12594843, 15306590, 16099792, 17682002, 18438406, 19235914, 19249008, 19302707, 21548950, 21752952, 21930071, 22275320, 22479607, 23665963, 25761185, 28269885, 31191543, 32641083, 34198814, 35538558, 39586377, 9060820, 9502407	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	15483662, 17993580, 18219280, 18438406, 18500230, 18830267, 19235914, 19592695, 19647622, 22479607, 23573954, 23665963, 24522266, 25761185, 26084578, 26278503, 26698117, 28139755, 28229296		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	CTD_human_DG	18438406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn`s disease of large bowel	Crohn`s Disease Of Large Bowel	CTD_human_DG	18438406		★☆☆☆☆ Found in Text Mining only
Crohn`s disease of the ileum	Crohn`s Disease Of The Ileum	CTD_human_DG	18438406		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18026571, 33050003	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	30973927	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25589894		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	18631256		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	18631256	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	38452989	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32998701	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22427475, 28821884, 30286163, 33975024	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	38317432	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	17179689	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12413772, 21749458		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	12413772		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	36197661	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23922971		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	15988104, 25179705, 28127111, 29513874, 34566972, 36903646	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22385239, 34944529	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23922971		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19956106, 24677179, 28127111, 32035746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22296201, 34944529	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24086540, 25179705, 34991588, 35482474, 36557031, 38009017	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	11175771, 11175794, 11972887, 11978670, 12078918, 12424623, 12424627, 15603869, 16005098, 16216674, 19956104, 23137633, 26915668		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22296201, 24957500		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	24463275	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	16966828		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	33206953	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	10655986, 15145461	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal dysplasia hypohidrotic with immune deficiency	Ectodermal dysplasia	Pubtator	16794254	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12413772		★☆☆☆☆ Found in Text Mining only
Encephalocele	Encephalocele	Pubtator	20222111	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23051953	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18295214, 27491770	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30865360		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	Pubtator	16754651	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	19274925	Associate	★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	19062180	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22740240, 23886125		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22740240, 23886125		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25144454	Inhibit	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	25945941	Associate	★☆☆☆☆ Found in Text Mining only
Factor XII Deficiency	Factor xii deficiency	Pubtator	11753820	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	20447453, 30929860, 37373402	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	15145461, 24069393, 30382864	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	15598979	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	32086386	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	22147555, 29731755	Associate	★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	21443923		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	22355254, 32043817	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	22355254	Stimulate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26820987	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34850166	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	18176109		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	11982607	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	30260027	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	15644581, 16005098, 16966828, 21198744, 22621617, 23164360, 26915668		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	16966828, 23164360, 35767887	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	23164360, 27612658, 32086386	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	LHGDN	18717726		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	21198744, 27774749		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	35767887	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	31142501	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	21362111	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	27183637	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22711645, 23388728, 25613737	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26783377	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	17634507, 25613737, 36534786	Associate	★☆☆☆☆ Found in Text Mining only
Hermansky Pudlak syndrome 2	Hermansky-pudlak syndrome	Pubtator	27207797	Associate	★☆☆☆☆ Found in Text Mining only
Hiatal Hernia	Hiatal Hernia	BEFREE	18192685		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	18077789, 19738032, 24141626, 31277552, 7718889	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21767511, 22070668, 22863216, 24158609, 25613737, 31277552		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22070668, 22863216, 24158609, 25613737		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	18050195	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27896842, 32322161, 34211061	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18163209		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	12841851	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	16966828		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	31350776	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	17056243	Associate	★☆☆☆☆ Found in Text Mining only
IIeocolitis	Ileocolitis	CTD_human_DG	18438406		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	10419892, 11298330, 34517836, 40503945, 8574836	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22515181		★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 29	Immunodeficiency	GENOMICS_ENGLAND_DG	24127073		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 29	Immunodeficiency	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 29	Immunodeficiency	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 29	Immunodeficiency	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	15483662, 18383521		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18383521, 19817673, 22479607, 23028907, 23103228, 23573954, 23830516, 24547735, 27693347, 28139755, 28449344		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22479607, 22496383, 23028907, 23830516, 25671699, 27281077, 31191543, 32661180, 37279927, 39586377, 9060820	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24086540, 38009017	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32620160	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	15483662		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	15654837	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	23065210		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	33511216	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	24489901	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22816602	Associate	★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	22503230		★☆☆☆☆ Found in Text Mining only
Keratitis Dendritic	Herpetic keratitis	Pubtator	22902724	Associate	★☆☆☆☆ Found in Text Mining only
Keratitis Herpetic	Herpetic keratitis	Pubtator	32867704	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	39390037	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	28651949	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25719218	Associate	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Leishmaniasis	Pubtator	25123642	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	11292765, 15976343, 23103228, 24578538, 32421744, 33819170	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	17445208, 23240095, 24578538		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	LHGDN	17445208		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10458772, 16338495, 38167707	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23071570		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16338495, 25757160, 32349161	Associate	★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19838195, 26808113		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31810916		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20521253, 25445750, 26631030, 27819525, 28415696		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	19458352, 24375552, 24648611, 28922472, 38228248	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	26783377	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25695689, 32884227	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	17326190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	17567674		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17567674, 24696530, 34960806	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19124500, 24568466	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11014347, 11359450, 18795942, 19838195, 26808113, 27059274, 27110576, 29475858, 31007604, 37543802	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11342672, 15498048, 31871930, 35444657	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	LHGDN	18821674		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15941730, 20658240, 21278068, 27059274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19838195, 26808113		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus nephritis	Pubtator	17324967, 18163476, 18795942, 19021013, 37460249	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17461482	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10390194, 18050195	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11940489		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17327408, 7718889	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17653830		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	7718889	Associate	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	28807602		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	18176109		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	11940489		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22702905		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22740240, 23886125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	17326190		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30396953		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31810916		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22515181, 22940148, 23065198, 25075970, 25445750, 28415696		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19118071, 19487916, 22614250		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	23429441	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10382738, 16801397, 18684935, 25695689, 25848976, 25889680, 30326165, 31703593, 35302641, 36610941, 39222576, 8706345, 9067406	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25848976		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25162674	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20384863	Inhibit	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	18176109		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25405820		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15180863	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	12562396, 27916909, 7500044, 9652827	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	15988104, 17900307, 17979888, 18431321, 20837847, 21622858, 23787171, 25690155, 32253768, 32457139, 33285358, 39201794, 8833901, 9012830, 9710434	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18082575, 22194214, 23787171, 24547735, 26000455, 28276258, 30069682		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	28276258, 30554348		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	LHGDN	16574246		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	9339364, 9624537		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	33050756, 9324294	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Transient myeloproliferative disorder	Pubtator	11966768	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17901940		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	23285065	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	38521068	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	24594700	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26239551	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16519741, 22327783		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	18632587		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	32038109	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	30629318	Inhibit	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38167707	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31670094		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24568505	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27494857	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	28103807	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36755691	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10849374	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23991654		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	26823856	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22021067, 25081699, 39985498	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28327095	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19798410	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28293095	Associate	★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	31572394	Associate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	24522266		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27220776	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37834363	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	16946717	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	18192685		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	10655986	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	15620465		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	22788685, 29306532		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	19210338		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	23592000, 29054963	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	37426324	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	18076766	Associate	★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	25405820		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	39768851	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32323770	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	22965887, 24463275	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	26589234		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	18631256		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	20639880		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	26084578		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	18573422	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26047319	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26047319, 32999046, 33678520, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	12413772, 17236132, 17587057, 18034172, 18219280, 19169254, 19169255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	15102082, 17236132, 17587057, 18219280, 18369459, 18614543, 18650833, 18800148, 18923449, 19035472, 19705136, 20415816, 20480402, 20875477, 21208785, 22482804, 22739501, 22897389, 23297015, 23376980, 23564024, 23662788, 23830516, 23844553, 23955419, 24135300, 24140476, 24547735, 24957500, 25006012, 25182136, 25406098, 25789703, 26472011, 26678060, 27068848, 27564082, 27829679, 29259305, 29389950, 29454820, 30785334, 31123311, 31131048		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	18369459, 18614543, 18800148, 19035472, 19169254, 22298274, 22897389, 23830516, 27670765, 31509228, 35297512, 35482474, 35563587	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19169254, 19169255, 20953190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	19169255, 20953190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	19169255, 20953190, 25903422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	12413772, 17388919, 18800148, 20084005, 23252691, 23564024, 25406098, 29454820		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17996064, 19279357, 22734699, 32017227	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	12193738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19169254, 19169255, 20953190		★☆☆☆☆ Found in Text Mining only
Regional enteritis	Crohn Disease	CTD_human_DG	18438406		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	30193587	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15993716, 19446472, 25469793, 26375522, 27155343, 27312970, 27896842		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	21749458		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	19274925, 26196693	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	18369459		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17827837, 18654018, 20851927, 26051272, 27460362	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18588591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18588591		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	29803226, 32038109, 39566744	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	27111665	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	20639880		★☆☆☆☆ Found in Text Mining only
Sensory neuropathy	Sensory neuropathy	BEFREE	18240960		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34134458, 34566996	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	15315967, 9649208	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10690174, 18050195, 19700754, 27142093, 31281310, 34295332	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29846789	Stimulate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35535423	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	10431691	Associate	★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	21743469, 26103568	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	39185422	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18547033, 35267186, 36529525	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31142501	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37505766	Stimulate	★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	18632587		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15515423, 17461482, 18505066, 28596683, 30223387	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15523691		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22167233	Associate	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	17002904, 23830516, 23830517, 25783557, 25931203, 26178430, 26996483, 28160070, 28277489, 28449344, 28874185, 29651889		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	ORPHANET_DG	23830507, 23830516		★☆☆☆☆ Found in Text Mining only
Takayasu arteritis	Takayasu Arteritis	Orphanet			★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	25589894	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	LHGDN	16574246		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	16966828, 23164360		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	31350776	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35377948	Associate	★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	29725107	Stimulate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18048021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	18438406, 20228799, 21297633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	18500230, 19592695, 19647622, 22479607, 23573954, 25761185, 25931203, 26698117, 28139755, 29651889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25292079	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	23521696	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17177206, 18288269, 22614250, 23280621, 34581419	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	26586929	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	24859272		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	24859272	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34292876	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	34211061	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	25405820		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36797040	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular stomatitis	Pubtator	28931520	Associate	★☆☆☆☆ Found in Text Mining only