Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	57658
Gene name	Calcium binding and coiled-coil domain 1
Gene symbol	CALCOCO1
Synonyms (NCBI Gene)	CocoaPP13275calphoglin
Chromosome	12
Chromosome location	12q13.13

88 Show/Hide all (88)

miRTarBase ID	miRNA	Experiments
MIRT858816	hsa-miR-3074-3p	CLIP-seq
MIRT858817	hsa-miR-3134	CLIP-seq
MIRT858818	hsa-miR-3201	CLIP-seq
MIRT858819	hsa-miR-3605-5p	CLIP-seq
MIRT858820	hsa-miR-3616-5p	CLIP-seq
MIRT858821	hsa-miR-3647-5p	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT858824	hsa-miR-4271	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT858826	hsa-miR-4687-3p	CLIP-seq
MIRT858827	hsa-miR-4716-3p	CLIP-seq
MIRT858828	hsa-miR-4725-3p	CLIP-seq
MIRT858829	hsa-miR-4791	CLIP-seq
MIRT858830	hsa-miR-4795-5p	CLIP-seq
MIRT858831	hsa-miR-573	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858833	hsa-miR-586	CLIP-seq
MIRT858834	hsa-miR-625	CLIP-seq
MIRT1546054	hsa-miR-1276	CLIP-seq
MIRT858819	hsa-miR-3605-5p	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT2192587	hsa-miR-361-5p	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT858826	hsa-miR-4687-3p	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT2495793	hsa-miR-122	CLIP-seq
MIRT2495794	hsa-miR-1324	CLIP-seq
MIRT2495795	hsa-miR-146a	CLIP-seq
MIRT2495796	hsa-miR-146b-5p	CLIP-seq
MIRT2495797	hsa-miR-2964a-5p	CLIP-seq
MIRT2495798	hsa-miR-3119	CLIP-seq
MIRT2495799	hsa-miR-3145-5p	CLIP-seq
MIRT2495800	hsa-miR-3166	CLIP-seq
MIRT2495801	hsa-miR-3189-5p	CLIP-seq
MIRT2495802	hsa-miR-3649	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT2495803	hsa-miR-3919	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT2495804	hsa-miR-4260	CLIP-seq
MIRT2495805	hsa-miR-4324	CLIP-seq
MIRT2495806	hsa-miR-4475	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT2495807	hsa-miR-4711-5p	CLIP-seq
MIRT2495808	hsa-miR-4758-3p	CLIP-seq
MIRT2495809	hsa-miR-4771	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT2495810	hsa-miR-492	CLIP-seq
MIRT2495811	hsa-miR-510	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858833	hsa-miR-586	CLIP-seq
MIRT2495812	hsa-miR-589	CLIP-seq
MIRT2495813	hsa-miR-595	CLIP-seq
MIRT2495793	hsa-miR-122	CLIP-seq
MIRT2495794	hsa-miR-1324	CLIP-seq
MIRT2495795	hsa-miR-146a	CLIP-seq
MIRT2495796	hsa-miR-146b-5p	CLIP-seq
MIRT2495797	hsa-miR-2964a-5p	CLIP-seq
MIRT2495798	hsa-miR-3119	CLIP-seq
MIRT2495799	hsa-miR-3145-5p	CLIP-seq
MIRT2495800	hsa-miR-3166	CLIP-seq
MIRT2495801	hsa-miR-3189-5p	CLIP-seq
MIRT2495802	hsa-miR-3649	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT2495803	hsa-miR-3919	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT2495804	hsa-miR-4260	CLIP-seq
MIRT2495805	hsa-miR-4324	CLIP-seq
MIRT2495806	hsa-miR-4475	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT2495807	hsa-miR-4711-5p	CLIP-seq
MIRT2495808	hsa-miR-4758-3p	CLIP-seq
MIRT2495809	hsa-miR-4771	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT2495810	hsa-miR-492	CLIP-seq
MIRT2495811	hsa-miR-510	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858833	hsa-miR-586	CLIP-seq
MIRT2495812	hsa-miR-589	CLIP-seq
MIRT2495813	hsa-miR-595	CLIP-seq

27 Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	24245781
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IDA	16344550
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	16344550, 24245781
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 16344550, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	ISS
GO:0008013	Function	Beta-catenin binding	IPI	16344550
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	16344550
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	16344550
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	16344550
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9P1Z2

Protein name

Calcium-binding and coiled-coil domain-containing protein 1 (Calphoglin) (Coiled-coil coactivator protein) (Sarcoma antigen NY-SAR-3)

Protein function

Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07888	CALCOCO1	122 → 596	Calcium binding and coiled-coil domain (CALCOCO1) like	Coiled-coil
PF17751	SKICH	15 → 118	SKICH domain	Domain
PF18112	Zn-C2H2_12	654 → 680	Autophagy receptor zinc finger-C2H2 domain	Domain

Sequence

MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD
YHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
PRPMDELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTI
SEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL
KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKAT
LLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSE
DESPEDMRLPPYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICK
ERFPAESDKDALEDHMDGHFFFSTQDPFTFE

Sequence length

691

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE FRACTURE	—	GWAS catalog	37919453	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	GWAS catalog	19165232	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Breast Neoplasms	Breast neoplasm	Pubtator	19183483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31104316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31953347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	GWASCAT_DG	19165232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	GWASDB_DG	19165232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34103471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CALCOCO1 (calcium binding and coiled-coil domain 1)

Bookmark This Gene