PRKCE (protein kinase C epsilon)

Gene

• Entrez ID: 5581
• Gene name: Protein kinase C epsilon
• Gene symbol: PRKCE
• Synonyms (NCBI Gene): PKCE, nPKC-epsilon
• Chromosome: 2
• Chromosome location: 2p21
• Summary: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003667	hsa-miR-205-5p	immunoblot, qRT-PCR	19244118
MIRT007205	hsa-miR-1-3p	Luciferase reporter assay	23226300
MIRT007286	hsa-miR-31-5p	Luciferase reporter assay	23364795
MIRT027937	hsa-miR-96-5p	Sequencing	20371350
MIRT030913	hsa-miR-21-5p	Microarray	18591254
MIRT043664	hsa-miR-342-3p	CLASH	23622248
MIRT052955	hsa-miR-107	5.0	22158047
MIRT052955	hsa-miR-107	5.0	22158047
MIRT052955	hsa-miR-107	5.0	22158047
MIRT052955	hsa-miR-107	5.0	22158047
MIRT052955	hsa-miR-107	Luciferase reporter assay, qRT-PCR, Western blot	22158047
MIRT438113	hsa-miR-146a-5p	Luciferase reporter assay	23457043
MIRT438113	hsa-miR-146a-5p	Luciferase reporter assay	23457043
MIRT438113	hsa-miR-146a-5p	Luciferase reporter assay	23457043
MIRT438113	hsa-miR-146a-5p	Luciferase reporter assay	23457043
MIRT438113	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	25308712
MIRT438113	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	25308712
MIRT438113	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	25308712
MIRT438113	hsa-miR-146a-5p	qRT-PCR, Luciferase reporter assay, Western blot	25308712
MIRT1263108	hsa-miR-101	CLIP-seq
MIRT1263109	hsa-miR-103a	CLIP-seq
MIRT1263110	hsa-miR-105	CLIP-seq
MIRT1263111	hsa-miR-1207-3p	CLIP-seq
MIRT1263112	hsa-miR-1208	CLIP-seq
MIRT1263113	hsa-miR-1227	CLIP-seq
MIRT1263114	hsa-miR-1271	CLIP-seq
MIRT1263115	hsa-miR-129-5p	CLIP-seq
MIRT1263116	hsa-miR-1301	CLIP-seq
MIRT1263117	hsa-miR-139-5p	CLIP-seq
MIRT1263118	hsa-miR-141	CLIP-seq
MIRT1263119	hsa-miR-144	CLIP-seq
MIRT1263120	hsa-miR-1470	CLIP-seq
MIRT1263121	hsa-miR-181a	CLIP-seq
MIRT1263122	hsa-miR-181b	CLIP-seq
MIRT1263123	hsa-miR-181c	CLIP-seq
MIRT1263124	hsa-miR-181d	CLIP-seq
MIRT1263125	hsa-miR-182	CLIP-seq
MIRT1263126	hsa-miR-186	CLIP-seq
MIRT1263127	hsa-miR-200a	CLIP-seq
MIRT1263128	hsa-miR-205	CLIP-seq
MIRT1263129	hsa-miR-216a	CLIP-seq
MIRT1263130	hsa-miR-2278	CLIP-seq
MIRT1263131	hsa-miR-23a	CLIP-seq
MIRT1263132	hsa-miR-23b	CLIP-seq
MIRT1263133	hsa-miR-23c	CLIP-seq
MIRT1263134	hsa-miR-25	CLIP-seq
MIRT1263135	hsa-miR-2909	CLIP-seq
MIRT1263136	hsa-miR-300	CLIP-seq
MIRT1263137	hsa-miR-3064-3p	CLIP-seq
MIRT1263138	hsa-miR-31	CLIP-seq
MIRT1263139	hsa-miR-3121-3p	CLIP-seq
MIRT1263140	hsa-miR-3146	CLIP-seq
MIRT1263141	hsa-miR-3151	CLIP-seq
MIRT1263142	hsa-miR-3153	CLIP-seq
MIRT1263143	hsa-miR-3180-5p	CLIP-seq
MIRT1263144	hsa-miR-3192	CLIP-seq
MIRT1263145	hsa-miR-32	CLIP-seq
MIRT1263146	hsa-miR-326	CLIP-seq
MIRT1263147	hsa-miR-329	CLIP-seq
MIRT1263148	hsa-miR-330-5p	CLIP-seq
MIRT1263149	hsa-miR-331-5p	CLIP-seq
MIRT1263150	hsa-miR-361-3p	CLIP-seq
MIRT1263151	hsa-miR-362-3p	CLIP-seq
MIRT1263152	hsa-miR-362-5p	CLIP-seq
MIRT1263153	hsa-miR-363	CLIP-seq
MIRT1263154	hsa-miR-3652	CLIP-seq
MIRT1263155	hsa-miR-3663-5p	CLIP-seq
MIRT1263156	hsa-miR-367	CLIP-seq
MIRT1263157	hsa-miR-3675-3p	CLIP-seq
MIRT1263158	hsa-miR-3690	CLIP-seq
MIRT1263159	hsa-miR-369-3p	CLIP-seq
MIRT1263160	hsa-miR-371-3p	CLIP-seq
MIRT1263161	hsa-miR-371-5p	CLIP-seq
MIRT1263162	hsa-miR-371b-3p	CLIP-seq
MIRT1263163	hsa-miR-371b-5p	CLIP-seq
MIRT1263164	hsa-miR-374a	CLIP-seq
MIRT1263165	hsa-miR-374b	CLIP-seq
MIRT1263166	hsa-miR-381	CLIP-seq
MIRT1263167	hsa-miR-3914	CLIP-seq
MIRT1263168	hsa-miR-3919	CLIP-seq
MIRT1263169	hsa-miR-3925-5p	CLIP-seq
MIRT1263170	hsa-miR-3926	CLIP-seq
MIRT1263171	hsa-miR-3938	CLIP-seq
MIRT1263172	hsa-miR-3978	CLIP-seq
MIRT1263173	hsa-miR-4252	CLIP-seq
MIRT1263174	hsa-miR-4255	CLIP-seq
MIRT1263175	hsa-miR-4261	CLIP-seq
MIRT1263176	hsa-miR-4262	CLIP-seq
MIRT1263177	hsa-miR-4277	CLIP-seq
MIRT1263178	hsa-miR-4278	CLIP-seq
MIRT1263179	hsa-miR-4282	CLIP-seq
MIRT1263180	hsa-miR-4283	CLIP-seq
MIRT1263181	hsa-miR-4287	CLIP-seq
MIRT1263182	hsa-miR-4289	CLIP-seq
MIRT1263183	hsa-miR-4314	CLIP-seq
MIRT1263184	hsa-miR-4320	CLIP-seq
MIRT1263185	hsa-miR-4422	CLIP-seq
MIRT1263186	hsa-miR-4430	CLIP-seq
MIRT1263187	hsa-miR-4432	CLIP-seq
MIRT1263188	hsa-miR-4457	CLIP-seq
MIRT1263189	hsa-miR-4459	CLIP-seq
MIRT1263190	hsa-miR-4469	CLIP-seq
MIRT1263191	hsa-miR-4473	CLIP-seq
MIRT1263192	hsa-miR-4489	CLIP-seq
MIRT1263193	hsa-miR-4492	CLIP-seq
MIRT1263194	hsa-miR-4498	CLIP-seq
MIRT1263195	hsa-miR-4638-3p	CLIP-seq
MIRT1263196	hsa-miR-4643	CLIP-seq
MIRT1263197	hsa-miR-4646-5p	CLIP-seq
MIRT1263198	hsa-miR-4651	CLIP-seq
MIRT1263199	hsa-miR-466	CLIP-seq
MIRT1263200	hsa-miR-4662a-5p	CLIP-seq
MIRT1263201	hsa-miR-4666-3p	CLIP-seq
MIRT1263202	hsa-miR-4667-3p	CLIP-seq
MIRT1263203	hsa-miR-4668-5p	CLIP-seq
MIRT1263204	hsa-miR-4671-3p	CLIP-seq
MIRT1263205	hsa-miR-4685-3p	CLIP-seq
MIRT1263206	hsa-miR-4688	CLIP-seq
MIRT1263207	hsa-miR-4700-3p	CLIP-seq
MIRT1263208	hsa-miR-4712-3p	CLIP-seq
MIRT1263209	hsa-miR-4715-3p	CLIP-seq
MIRT1263210	hsa-miR-4731-3p	CLIP-seq
MIRT1263211	hsa-miR-4766-5p	CLIP-seq
MIRT1263212	hsa-miR-4773	CLIP-seq
MIRT1263213	hsa-miR-4776-3p	CLIP-seq
MIRT1263214	hsa-miR-4789-3p	CLIP-seq
MIRT1263215	hsa-miR-4789-5p	CLIP-seq
MIRT1263216	hsa-miR-4790-3p	CLIP-seq
MIRT1263217	hsa-miR-4795-3p	CLIP-seq
MIRT1263218	hsa-miR-4797-5p	CLIP-seq
MIRT1263219	hsa-miR-4801	CLIP-seq
MIRT1263220	hsa-miR-486-3p	CLIP-seq
MIRT1263221	hsa-miR-491-3p	CLIP-seq
MIRT1263222	hsa-miR-494	CLIP-seq
MIRT1263223	hsa-miR-496	CLIP-seq
MIRT1263224	hsa-miR-499-5p	CLIP-seq
MIRT1263225	hsa-miR-500b	CLIP-seq
MIRT1263226	hsa-miR-501-5p	CLIP-seq
MIRT1263227	hsa-miR-5047	CLIP-seq
MIRT1263228	hsa-miR-513b	CLIP-seq
MIRT1263229	hsa-miR-515-3p	CLIP-seq
MIRT1263230	hsa-miR-519e	CLIP-seq
MIRT1263231	hsa-miR-520a-5p	CLIP-seq
MIRT1263232	hsa-miR-525-5p	CLIP-seq
MIRT1263233	hsa-miR-545	CLIP-seq
MIRT1263234	hsa-miR-548c-3p	CLIP-seq
MIRT1263235	hsa-miR-548s	CLIP-seq
MIRT1263236	hsa-miR-589	CLIP-seq
MIRT1263237	hsa-miR-598	CLIP-seq
MIRT1263238	hsa-miR-600	CLIP-seq
MIRT1263239	hsa-miR-608	CLIP-seq
MIRT1263240	hsa-miR-616	CLIP-seq
MIRT1263241	hsa-miR-619	CLIP-seq
MIRT1263242	hsa-miR-670	CLIP-seq
MIRT1263243	hsa-miR-762	CLIP-seq
MIRT1263244	hsa-miR-875-3p	CLIP-seq
MIRT1263245	hsa-miR-92a	CLIP-seq
MIRT1263246	hsa-miR-92b	CLIP-seq
MIRT1263247	hsa-miR-96	CLIP-seq
MIRT2077448	hsa-miR-1	CLIP-seq
MIRT1263109	hsa-miR-103a	CLIP-seq
MIRT1263110	hsa-miR-105	CLIP-seq
MIRT1263111	hsa-miR-1207-3p	CLIP-seq
MIRT1263113	hsa-miR-1227	CLIP-seq
MIRT2077449	hsa-miR-1323	CLIP-seq
MIRT1263118	hsa-miR-141	CLIP-seq
MIRT2077450	hsa-miR-146a	CLIP-seq
MIRT2077451	hsa-miR-146b-5p	CLIP-seq
MIRT2077452	hsa-miR-1911	CLIP-seq
MIRT2077453	hsa-miR-199a-3p	CLIP-seq
MIRT2077454	hsa-miR-199b-3p	CLIP-seq
MIRT1263127	hsa-miR-200a	CLIP-seq
MIRT2077455	hsa-miR-206	CLIP-seq
MIRT1263129	hsa-miR-216a	CLIP-seq
MIRT1263135	hsa-miR-2909	CLIP-seq
MIRT1263137	hsa-miR-3064-3p	CLIP-seq
MIRT1263138	hsa-miR-31	CLIP-seq
MIRT2077456	hsa-miR-3129-5p	CLIP-seq
MIRT2077457	hsa-miR-3148	CLIP-seq
MIRT1263142	hsa-miR-3153	CLIP-seq
MIRT2077458	hsa-miR-3673	CLIP-seq
MIRT1263159	hsa-miR-369-3p	CLIP-seq
MIRT1263161	hsa-miR-371-5p	CLIP-seq
MIRT1263163	hsa-miR-371b-5p	CLIP-seq
MIRT1263164	hsa-miR-374a	CLIP-seq
MIRT1263165	hsa-miR-374b	CLIP-seq
MIRT2077459	hsa-miR-376a	CLIP-seq
MIRT2077460	hsa-miR-376b	CLIP-seq
MIRT2077461	hsa-miR-377	CLIP-seq
MIRT1263169	hsa-miR-3925-5p	CLIP-seq
MIRT1263173	hsa-miR-4252	CLIP-seq
MIRT1263178	hsa-miR-4278	CLIP-seq
MIRT1263179	hsa-miR-4282	CLIP-seq
MIRT1263188	hsa-miR-4457	CLIP-seq
MIRT2077462	hsa-miR-4517	CLIP-seq
MIRT2077463	hsa-miR-4633-5p	CLIP-seq
MIRT1263196	hsa-miR-4643	CLIP-seq
MIRT1263197	hsa-miR-4646-5p	CLIP-seq
MIRT2077464	hsa-miR-4652-3p	CLIP-seq
MIRT1263203	hsa-miR-4668-5p	CLIP-seq
MIRT1263206	hsa-miR-4688	CLIP-seq
MIRT1263209	hsa-miR-4715-3p	CLIP-seq
MIRT1263213	hsa-miR-4776-3p	CLIP-seq
MIRT1263216	hsa-miR-4790-3p	CLIP-seq
MIRT1263218	hsa-miR-4797-5p	CLIP-seq
MIRT1263220	hsa-miR-486-3p	CLIP-seq
MIRT1263222	hsa-miR-494	CLIP-seq
MIRT2077465	hsa-miR-5096	CLIP-seq
MIRT1263228	hsa-miR-513b	CLIP-seq
MIRT2077466	hsa-miR-532-5p	CLIP-seq
MIRT2077467	hsa-miR-548a-3p	CLIP-seq
MIRT2077468	hsa-miR-548e	CLIP-seq
MIRT2077469	hsa-miR-548f	CLIP-seq
MIRT2077470	hsa-miR-548o	CLIP-seq
MIRT2077471	hsa-miR-561	CLIP-seq
MIRT2077472	hsa-miR-613	CLIP-seq
MIRT2077473	hsa-miR-875-5p	CLIP-seq
MIRT2077474	hsa-miR-944	CLIP-seq
MIRT2077448	hsa-miR-1	CLIP-seq
MIRT1263108	hsa-miR-101	CLIP-seq
MIRT1263109	hsa-miR-103a	CLIP-seq
MIRT1263110	hsa-miR-105	CLIP-seq
MIRT1263111	hsa-miR-1207-3p	CLIP-seq
MIRT1263113	hsa-miR-1227	CLIP-seq
MIRT2304017	hsa-miR-1245b-5p	CLIP-seq
MIRT2304018	hsa-miR-1246	CLIP-seq
MIRT2304019	hsa-miR-1248	CLIP-seq
MIRT1263114	hsa-miR-1271	CLIP-seq
MIRT1263116	hsa-miR-1301	CLIP-seq
MIRT1263118	hsa-miR-141	CLIP-seq
MIRT1263119	hsa-miR-144	CLIP-seq
MIRT1263121	hsa-miR-181a	CLIP-seq
MIRT1263122	hsa-miR-181b	CLIP-seq
MIRT1263123	hsa-miR-181c	CLIP-seq
MIRT1263124	hsa-miR-181d	CLIP-seq
MIRT1263125	hsa-miR-182	CLIP-seq
MIRT1263127	hsa-miR-200a	CLIP-seq
MIRT2077455	hsa-miR-206	CLIP-seq
MIRT1263131	hsa-miR-23a	CLIP-seq
MIRT1263132	hsa-miR-23b	CLIP-seq
MIRT1263133	hsa-miR-23c	CLIP-seq
MIRT1263134	hsa-miR-25	CLIP-seq
MIRT1263137	hsa-miR-3064-3p	CLIP-seq
MIRT1263138	hsa-miR-31	CLIP-seq
MIRT2304020	hsa-miR-3127-3p	CLIP-seq
MIRT2304021	hsa-miR-3130-3p	CLIP-seq
MIRT2304022	hsa-miR-3142	CLIP-seq
MIRT1263142	hsa-miR-3153	CLIP-seq
MIRT1263144	hsa-miR-3192	CLIP-seq
MIRT1263145	hsa-miR-32	CLIP-seq
MIRT1263146	hsa-miR-326	CLIP-seq
MIRT1263148	hsa-miR-330-5p	CLIP-seq
MIRT1263149	hsa-miR-331-5p	CLIP-seq
MIRT1263153	hsa-miR-363	CLIP-seq
MIRT1263156	hsa-miR-367	CLIP-seq
MIRT2077458	hsa-miR-3673	CLIP-seq
MIRT1263158	hsa-miR-3690	CLIP-seq
MIRT2304023	hsa-miR-3692	CLIP-seq
MIRT1263160	hsa-miR-371-3p	CLIP-seq
MIRT1263162	hsa-miR-371b-3p	CLIP-seq
MIRT1263171	hsa-miR-3938	CLIP-seq
MIRT1263173	hsa-miR-4252	CLIP-seq
MIRT2304024	hsa-miR-4259	CLIP-seq
MIRT1263175	hsa-miR-4261	CLIP-seq
MIRT1263176	hsa-miR-4262	CLIP-seq
MIRT1263177	hsa-miR-4277	CLIP-seq
MIRT2304025	hsa-miR-4294	CLIP-seq
MIRT1263183	hsa-miR-4314	CLIP-seq
MIRT1263184	hsa-miR-4320	CLIP-seq
MIRT1263188	hsa-miR-4457	CLIP-seq
MIRT1263191	hsa-miR-4473	CLIP-seq
MIRT1263195	hsa-miR-4638-3p	CLIP-seq
MIRT1263196	hsa-miR-4643	CLIP-seq
MIRT1263197	hsa-miR-4646-5p	CLIP-seq
MIRT2304026	hsa-miR-4650-5p	CLIP-seq
MIRT2304027	hsa-miR-4659a-5p	CLIP-seq
MIRT2304028	hsa-miR-4659b-5p	CLIP-seq
MIRT1263199	hsa-miR-466	CLIP-seq
MIRT1263203	hsa-miR-4668-5p	CLIP-seq
MIRT1263204	hsa-miR-4671-3p	CLIP-seq
MIRT1263209	hsa-miR-4715-3p	CLIP-seq
MIRT2304029	hsa-miR-4715-5p	CLIP-seq
MIRT1263213	hsa-miR-4776-3p	CLIP-seq
MIRT1263214	hsa-miR-4789-3p	CLIP-seq
MIRT1263216	hsa-miR-4790-3p	CLIP-seq
MIRT2304030	hsa-miR-4793-3p	CLIP-seq
MIRT1263217	hsa-miR-4795-3p	CLIP-seq
MIRT1263218	hsa-miR-4797-5p	CLIP-seq
MIRT2304031	hsa-miR-485-3p	CLIP-seq
MIRT1263220	hsa-miR-486-3p	CLIP-seq
MIRT1263222	hsa-miR-494	CLIP-seq
MIRT1263223	hsa-miR-496	CLIP-seq
MIRT1263226	hsa-miR-501-5p	CLIP-seq
MIRT1263227	hsa-miR-5047	CLIP-seq
MIRT1263228	hsa-miR-513b	CLIP-seq
MIRT1263229	hsa-miR-515-3p	CLIP-seq
MIRT1263230	hsa-miR-519e	CLIP-seq
MIRT1263233	hsa-miR-545	CLIP-seq
MIRT1263238	hsa-miR-600	CLIP-seq
MIRT2077472	hsa-miR-613	CLIP-seq
MIRT1263241	hsa-miR-619	CLIP-seq
MIRT2077473	hsa-miR-875-5p	CLIP-seq
MIRT2304032	hsa-miR-891a	CLIP-seq
MIRT2304033	hsa-miR-924	CLIP-seq
MIRT1263245	hsa-miR-92a	CLIP-seq
MIRT1263246	hsa-miR-92b	CLIP-seq
MIRT2304034	hsa-miR-942	CLIP-seq
MIRT1263247	hsa-miR-96	CLIP-seq
MIRT2077449	hsa-miR-1323	CLIP-seq
MIRT2077457	hsa-miR-3148	CLIP-seq
MIRT2304023	hsa-miR-3692	CLIP-seq
MIRT2393025	hsa-miR-4443	CLIP-seq
MIRT1263218	hsa-miR-4797-5p	CLIP-seq
MIRT2077465	hsa-miR-5096	CLIP-seq
MIRT2077470	hsa-miR-548o	CLIP-seq
MIRT2393026	hsa-miR-765	CLIP-seq
MIRT1263134	hsa-miR-25	CLIP-seq
MIRT1263145	hsa-miR-32	CLIP-seq
MIRT1263153	hsa-miR-363	CLIP-seq
MIRT1263156	hsa-miR-367	CLIP-seq
MIRT1263158	hsa-miR-3690	CLIP-seq
MIRT1263195	hsa-miR-4638-3p	CLIP-seq
MIRT1263217	hsa-miR-4795-3p	CLIP-seq
MIRT1263218	hsa-miR-4797-5p	CLIP-seq
MIRT1263223	hsa-miR-496	CLIP-seq
MIRT1263241	hsa-miR-619	CLIP-seq
MIRT1263245	hsa-miR-92a	CLIP-seq
MIRT1263246	hsa-miR-92b	CLIP-seq
MIRT1263108	hsa-miR-101	CLIP-seq
MIRT1263112	hsa-miR-1208	CLIP-seq
MIRT2600907	hsa-miR-1226	CLIP-seq
MIRT2600908	hsa-miR-1237	CLIP-seq
MIRT1263114	hsa-miR-1271	CLIP-seq
MIRT1263117	hsa-miR-139-5p	CLIP-seq
MIRT1263118	hsa-miR-141	CLIP-seq
MIRT1263119	hsa-miR-144	CLIP-seq
MIRT1263121	hsa-miR-181a	CLIP-seq
MIRT1263122	hsa-miR-181b	CLIP-seq
MIRT1263123	hsa-miR-181c	CLIP-seq
MIRT1263124	hsa-miR-181d	CLIP-seq
MIRT1263125	hsa-miR-182	CLIP-seq
MIRT2600909	hsa-miR-188-5p	CLIP-seq
MIRT1263127	hsa-miR-200a	CLIP-seq
MIRT2600910	hsa-miR-218	CLIP-seq
MIRT2600911	hsa-miR-219-1-3p	CLIP-seq
MIRT1263131	hsa-miR-23a	CLIP-seq
MIRT1263132	hsa-miR-23b	CLIP-seq
MIRT1263133	hsa-miR-23c	CLIP-seq
MIRT1263134	hsa-miR-25	CLIP-seq
MIRT1263139	hsa-miR-3121-3p	CLIP-seq
MIRT2600912	hsa-miR-3123	CLIP-seq
MIRT2600913	hsa-miR-3138	CLIP-seq
MIRT2600914	hsa-miR-3150b-3p	CLIP-seq
MIRT2600915	hsa-miR-3160-3p	CLIP-seq
MIRT1263144	hsa-miR-3192	CLIP-seq
MIRT1263145	hsa-miR-32	CLIP-seq
MIRT2600916	hsa-miR-339-3p	CLIP-seq
MIRT1263150	hsa-miR-361-3p	CLIP-seq
MIRT1263153	hsa-miR-363	CLIP-seq
MIRT1263155	hsa-miR-3663-5p	CLIP-seq
MIRT1263156	hsa-miR-367	CLIP-seq
MIRT1263157	hsa-miR-3675-3p	CLIP-seq
MIRT2600917	hsa-miR-3689a-3p	CLIP-seq
MIRT2600918	hsa-miR-3689c	CLIP-seq
MIRT2600919	hsa-miR-3689d	CLIP-seq
MIRT1263158	hsa-miR-3690	CLIP-seq
MIRT1263159	hsa-miR-369-3p	CLIP-seq
MIRT1263164	hsa-miR-374a	CLIP-seq
MIRT1263165	hsa-miR-374b	CLIP-seq
MIRT2077459	hsa-miR-376a	CLIP-seq
MIRT2077460	hsa-miR-376b	CLIP-seq
MIRT2077461	hsa-miR-377	CLIP-seq
MIRT2600920	hsa-miR-3925-3p	CLIP-seq
MIRT1263172	hsa-miR-3978	CLIP-seq
MIRT1263176	hsa-miR-4262	CLIP-seq
MIRT2600921	hsa-miR-4299	CLIP-seq
MIRT2600922	hsa-miR-4300	CLIP-seq
MIRT2600923	hsa-miR-4311	CLIP-seq
MIRT1263183	hsa-miR-4314	CLIP-seq
MIRT1263189	hsa-miR-4459	CLIP-seq
MIRT2600924	hsa-miR-4474-5p	CLIP-seq
MIRT2600925	hsa-miR-4523	CLIP-seq
MIRT1263195	hsa-miR-4638-3p	CLIP-seq
MIRT1263196	hsa-miR-4643	CLIP-seq
MIRT1263197	hsa-miR-4646-5p	CLIP-seq
MIRT2077464	hsa-miR-4652-3p	CLIP-seq
MIRT2304027	hsa-miR-4659a-5p	CLIP-seq
MIRT2304028	hsa-miR-4659b-5p	CLIP-seq
MIRT1263199	hsa-miR-466	CLIP-seq
MIRT2600926	hsa-miR-4662a-3p	CLIP-seq
MIRT2600927	hsa-miR-4663	CLIP-seq
MIRT2600928	hsa-miR-4671-5p	CLIP-seq
MIRT1263207	hsa-miR-4700-3p	CLIP-seq
MIRT2600929	hsa-miR-4710	CLIP-seq
MIRT1263209	hsa-miR-4715-3p	CLIP-seq
MIRT2600930	hsa-miR-4716-3p	CLIP-seq
MIRT2600931	hsa-miR-4723-5p	CLIP-seq
MIRT2600932	hsa-miR-4728-5p	CLIP-seq
MIRT2600933	hsa-miR-4733-3p	CLIP-seq
MIRT2600934	hsa-miR-4738-3p	CLIP-seq
MIRT2600935	hsa-miR-4768-5p	CLIP-seq
MIRT1263213	hsa-miR-4776-3p	CLIP-seq
MIRT2600936	hsa-miR-4784	CLIP-seq
MIRT1263214	hsa-miR-4789-3p	CLIP-seq
MIRT2600937	hsa-miR-4792	CLIP-seq
MIRT1263217	hsa-miR-4795-3p	CLIP-seq
MIRT1263218	hsa-miR-4797-5p	CLIP-seq
MIRT1263220	hsa-miR-486-3p	CLIP-seq
MIRT1263222	hsa-miR-494	CLIP-seq
MIRT1263223	hsa-miR-496	CLIP-seq
MIRT1263226	hsa-miR-501-5p	CLIP-seq
MIRT2600938	hsa-miR-508-5p	CLIP-seq
MIRT2600939	hsa-miR-548b-3p	CLIP-seq
MIRT2600940	hsa-miR-571	CLIP-seq
MIRT2600941	hsa-miR-577	CLIP-seq
MIRT1263241	hsa-miR-619	CLIP-seq
MIRT2600942	hsa-miR-627	CLIP-seq
MIRT2600943	hsa-miR-636	CLIP-seq
MIRT2600944	hsa-miR-661	CLIP-seq
MIRT2393026	hsa-miR-765	CLIP-seq
MIRT2600945	hsa-miR-766	CLIP-seq
MIRT1263244	hsa-miR-875-3p	CLIP-seq
MIRT2600946	hsa-miR-888	CLIP-seq
MIRT2600947	hsa-miR-920	CLIP-seq
MIRT2304033	hsa-miR-924	CLIP-seq
MIRT1263245	hsa-miR-92a	CLIP-seq
MIRT1263246	hsa-miR-92b	CLIP-seq
MIRT2077474	hsa-miR-944	CLIP-seq
MIRT1263247	hsa-miR-96	CLIP-seq
MIRT1263108	hsa-miR-101	CLIP-seq
MIRT1263112	hsa-miR-1208	CLIP-seq
MIRT2600907	hsa-miR-1226	CLIP-seq
MIRT2600908	hsa-miR-1237	CLIP-seq
MIRT1263117	hsa-miR-139-5p	CLIP-seq
MIRT1263118	hsa-miR-141	CLIP-seq
MIRT1263119	hsa-miR-144	CLIP-seq
MIRT1263121	hsa-miR-181a	CLIP-seq
MIRT1263122	hsa-miR-181b	CLIP-seq
MIRT1263123	hsa-miR-181c	CLIP-seq
MIRT1263124	hsa-miR-181d	CLIP-seq
MIRT1263127	hsa-miR-200a	CLIP-seq
MIRT2600910	hsa-miR-218	CLIP-seq
MIRT1263131	hsa-miR-23a	CLIP-seq
MIRT1263132	hsa-miR-23b	CLIP-seq
MIRT1263133	hsa-miR-23c	CLIP-seq
MIRT2600916	hsa-miR-339-3p	CLIP-seq
MIRT1263155	hsa-miR-3663-5p	CLIP-seq
MIRT2600917	hsa-miR-3689a-3p	CLIP-seq
MIRT2600918	hsa-miR-3689c	CLIP-seq
MIRT2600919	hsa-miR-3689d	CLIP-seq
MIRT1263176	hsa-miR-4262	CLIP-seq
MIRT2600921	hsa-miR-4299	CLIP-seq
MIRT1263189	hsa-miR-4459	CLIP-seq
MIRT2600925	hsa-miR-4523	CLIP-seq
MIRT1263196	hsa-miR-4643	CLIP-seq
MIRT2077464	hsa-miR-4652-3p	CLIP-seq
MIRT1263199	hsa-miR-466	CLIP-seq
MIRT1263207	hsa-miR-4700-3p	CLIP-seq
MIRT2600929	hsa-miR-4710	CLIP-seq
MIRT2600930	hsa-miR-4716-3p	CLIP-seq
MIRT2600931	hsa-miR-4723-5p	CLIP-seq
MIRT2600932	hsa-miR-4728-5p	CLIP-seq
MIRT2600933	hsa-miR-4733-3p	CLIP-seq
MIRT1263214	hsa-miR-4789-3p	CLIP-seq
MIRT2600937	hsa-miR-4792	CLIP-seq
MIRT1263222	hsa-miR-494	CLIP-seq
MIRT1263226	hsa-miR-501-5p	CLIP-seq
MIRT2600939	hsa-miR-548b-3p	CLIP-seq
MIRT2600942	hsa-miR-627	CLIP-seq
MIRT2600943	hsa-miR-636	CLIP-seq
MIRT2393026	hsa-miR-765	CLIP-seq
MIRT2304033	hsa-miR-924	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PAX5	Unknown	9190940
SP1	Repression	24825907
STAT1	Repression	24825907

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003785	Function	Actin monomer binding	IEA
GO:0003785	Function	Actin monomer binding	ISS
GO:0004672	Function	Protein kinase activity	IDA	19542546, 34593629
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15695813
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	TAS	1382605
GO:0004699	Function	Diacylglycerol-dependent, calcium-independent serine/threonine kinase activity	IDA	18556656
GO:0004699	Function	Diacylglycerol-dependent, calcium-independent serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16810323, 19542546, 19662078, 20353823, 21625473, 22939624, 24996056, 28934384, 31980649, 32814053, 34593629, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	15632189, 19542546
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	18556656
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	IDA	17603037
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	15632189, 17603037
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	TAS	10438519
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1382605
GO:0008047	Function	Enzyme activator activity	IMP	18556656
GO:0008270	Function	Zinc ion binding	IEA
GO:0009407	Process	Toxin catabolic process	IDA	18556656
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	17603037
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010763	Process	Positive regulation of fibroblast migration	ISS
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0010959	Process	Regulation of metal ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15695813
GO:0019216	Process	Regulation of lipid metabolic process	IEA
GO:0019899	Function	Enzyme binding	IPI	15632189, 18556656
GO:0030073	Process	Insulin secretion	IEA
GO:0030546	Function	Signaling receptor activator activity	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	ISS
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	18604201
GO:0032930	Process	Positive regulation of superoxide anion generation	TAS	19193863
GO:0035276	Function	Ethanol binding	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035641	Process	Locomotory exploration behavior	IEA
GO:0035669	Process	TRAM-dependent toll-like receptor 4 signaling pathway	IEA
GO:0035669	Process	TRAM-dependent toll-like receptor 4 signaling pathway	ISS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042178	Process	Xenobiotic catabolic process	IMP	18556656
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0050996	Process	Positive regulation of lipid catabolic process	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051301	Process	Cell division	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051932	Process	Synaptic transmission, GABAergic	IEA
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0070254	Process	Mucus secretion	IEA
GO:0070257	Process	Positive regulation of mucus secretion	IEA
GO:0071361	Process	Cellular response to ethanol	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071889	Function	14-3-3 protein binding	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0071944	Component	Cell periphery	ISS
GO:0090303	Process	Positive regulation of wound healing	IMP	17603037
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1902306	Process	Negative regulation of sodium ion transmembrane transport	TAS	19193863
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	TAS	22732145
GO:1904062	Process	Regulation of monoatomic cation transmembrane transport	IEA

Other IDs

• MIM: 176975
• HGNC: 9401
• e!Ensembl: ENSG00000171132

Protein

• UniProt ID: Q02156
• Protein name: Protein kinase C epsilon type (EC 2.7.11.13) (nPKC-epsilon)
• Protein function: Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, m
• PDB: 2WH0, 5LIH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00168	C2	6 → 119	C2 domain	Domain
  PF00130	C1_1	170 → 223	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00130	C1_1	243 → 295	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00069	Pkinase	408 → 668	Protein kinase domain	Domain
  PF00433	Pkinase_C	689 → 730	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in cumulus cells (at protein level). {ECO:0000269|PubMed:19542546}.
• Sequence:

  MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
  NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
  PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
  TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
  MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
  KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
  NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
  KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
  RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
  DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
  MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
  AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
  NQEEFKGFSYFGEDLMP

• Sequence length: 737

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYTHEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	24848988, 34062866	Associate	★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta nephrocalcinosis	Amelogenesis Imperfecta	BEFREE	28715866		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	37629005	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	29280140	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	26031901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	38057311	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24888992		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	35039944	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35577881	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	35577881	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24825907		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12628005, 16785234, 19633292, 21720730, 23562764, 24825907, 32549199, 33490232, 34433666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32429937, 9683604	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36782184	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26637171	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17760843, 20459627, 21955404	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29636077	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	15242976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	15242976		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	27072078	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	22940544		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22940544		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27072078	Associate	★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	21955404		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	7705931		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	7705931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21955404		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23071564		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23071564		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	23071564		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	CTD_human_DG	16782078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Melanoma	Melanoma	BEFREE	20228845		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	11956211		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	19573263	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	24372385	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31869513, 32993798	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30181290		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	20665664		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38194422	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	24372385	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28492560		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26943771		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26943771, 29439667	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26943771		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	16103081, 35577881	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	24888992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	29439667	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	21964026		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	29280140	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	9727032	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35985686	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	7512966, 9727032	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	19864212	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18988868	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28765889		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26212029	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	19233941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	18342628	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12121973		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12121973, 24070896, 30923343	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15379867	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22102710	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	22102710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24825907		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28492560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	19233941		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21406403, 22955280		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21441608, 21964064, 29021232, 30209539		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18317451		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15827341		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	1988168, 22304920, 25728676, 7678596	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20112030		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	15242976		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	16782078		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	23071564		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	23071564, 30765820	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	21955404, 24888992		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15189345, 17697049, 18408015, 19077250	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17697049		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	20665664		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23931760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29341352		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29341352		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	27072078	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17678893	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37833790	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23457043		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	20726883		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	21406403, 22955280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12185081, 20566643, 21824498, 23076676, 23826267, 30209539, 9916928	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15467757		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24825907	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	29280140	Associate	★☆☆☆☆ Found in Text Mining only
SHORT syndrome	SHORT Syndrome	BEFREE	28934384		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12121973, 16810323	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17018591	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	27081176	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23457043		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37667176	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22653968	Associate	★☆☆☆☆ Found in Text Mining only