Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5467
Gene name	Peroxisome proliferator activated receptor delta
Gene symbol	PPARD
Synonyms (NCBI Gene)	FAARNR1C2NUC1NUCINUCIIPPARB
Chromosome	6
Chromosome location	6p21.31
Summary	This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcr

268

Show/Hide all (268)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049777	hsa-miR-92a-3p	CLASH	23622248
MIRT043275	hsa-miR-331-3p	CLASH	23622248
MIRT053749	hsa-miR-29b-3p	Microarray	22942087
MIRT439926	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439926	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1251745	hsa-miR-106a	CLIP-seq
MIRT1251746	hsa-miR-106b	CLIP-seq
MIRT1251747	hsa-miR-1205	CLIP-seq
MIRT1251748	hsa-miR-1266	CLIP-seq
MIRT1251749	hsa-miR-1321	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT1251753	hsa-miR-17	CLIP-seq
MIRT1251754	hsa-miR-20a	CLIP-seq
MIRT1251755	hsa-miR-20b	CLIP-seq
MIRT1251756	hsa-miR-3202	CLIP-seq
MIRT1251757	hsa-miR-34a	CLIP-seq
MIRT1251758	hsa-miR-34c-5p	CLIP-seq
MIRT1251759	hsa-miR-3609	CLIP-seq
MIRT1251760	hsa-miR-3665	CLIP-seq
MIRT1251761	hsa-miR-3689d	CLIP-seq
MIRT1251762	hsa-miR-4270	CLIP-seq
MIRT1251763	hsa-miR-4441	CLIP-seq
MIRT1251764	hsa-miR-449a	CLIP-seq
MIRT1251765	hsa-miR-449b	CLIP-seq
MIRT1251766	hsa-miR-4518	CLIP-seq
MIRT1251767	hsa-miR-4728-5p	CLIP-seq
MIRT1251768	hsa-miR-4730	CLIP-seq
MIRT1251769	hsa-miR-4739	CLIP-seq
MIRT1251770	hsa-miR-4747-5p	CLIP-seq
MIRT1251771	hsa-miR-4756-5p	CLIP-seq
MIRT1251772	hsa-miR-4796-3p	CLIP-seq
MIRT1251773	hsa-miR-486-3p	CLIP-seq
MIRT1251774	hsa-miR-512-3p	CLIP-seq
MIRT1251775	hsa-miR-519d	CLIP-seq
MIRT1251776	hsa-miR-520f	CLIP-seq
MIRT1251777	hsa-miR-548ah	CLIP-seq
MIRT1251778	hsa-miR-596	CLIP-seq
MIRT1251779	hsa-miR-657	CLIP-seq
MIRT1251780	hsa-miR-93	CLIP-seq
MIRT1251745	hsa-miR-106a	CLIP-seq
MIRT1251746	hsa-miR-106b	CLIP-seq
MIRT1251747	hsa-miR-1205	CLIP-seq
MIRT1251781	hsa-miR-1262	CLIP-seq
MIRT1251782	hsa-miR-1287	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT1251753	hsa-miR-17	CLIP-seq
MIRT1251754	hsa-miR-20a	CLIP-seq
MIRT1251755	hsa-miR-20b	CLIP-seq
MIRT1251784	hsa-miR-2115	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT1251786	hsa-miR-3184	CLIP-seq
MIRT1251787	hsa-miR-3194-3p	CLIP-seq
MIRT1251788	hsa-miR-3195	CLIP-seq
MIRT1251759	hsa-miR-3609	CLIP-seq
MIRT1251789	hsa-miR-3622b-5p	CLIP-seq
MIRT1251760	hsa-miR-3665	CLIP-seq
MIRT1251790	hsa-miR-423-5p	CLIP-seq
MIRT1251791	hsa-miR-4455	CLIP-seq
MIRT1251792	hsa-miR-4688	CLIP-seq
MIRT1251793	hsa-miR-4691-5p	CLIP-seq
MIRT1251794	hsa-miR-4701-3p	CLIP-seq
MIRT1251772	hsa-miR-4796-3p	CLIP-seq
MIRT1251773	hsa-miR-486-3p	CLIP-seq
MIRT1251795	hsa-miR-516a-3p	CLIP-seq
MIRT1251775	hsa-miR-519d	CLIP-seq
MIRT1251776	hsa-miR-520f	CLIP-seq
MIRT1251777	hsa-miR-548ah	CLIP-seq
MIRT1251778	hsa-miR-596	CLIP-seq
MIRT1251796	hsa-miR-609	CLIP-seq
MIRT1251779	hsa-miR-657	CLIP-seq
MIRT1251797	hsa-miR-760	CLIP-seq
MIRT1251780	hsa-miR-93	CLIP-seq
MIRT1251798	hsa-miR-1182	CLIP-seq
MIRT1251799	hsa-miR-122	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT1251800	hsa-miR-3166	CLIP-seq
MIRT1251801	hsa-miR-3615	CLIP-seq
MIRT1251802	hsa-miR-3652	CLIP-seq
MIRT1251803	hsa-miR-3664-5p	CLIP-seq
MIRT1251804	hsa-miR-3692	CLIP-seq
MIRT1251805	hsa-miR-4430	CLIP-seq
MIRT1251806	hsa-miR-4639-3p	CLIP-seq
MIRT1251807	hsa-miR-4771	CLIP-seq
MIRT1251808	hsa-miR-498	CLIP-seq
MIRT1251809	hsa-miR-541	CLIP-seq
MIRT1251810	hsa-miR-654-5p	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT2074245	hsa-miR-4251	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT2301234	hsa-miR-1193	CLIP-seq
MIRT2301235	hsa-miR-1207-5p	CLIP-seq
MIRT2301236	hsa-miR-1285	CLIP-seq
MIRT1251750	hsa-miR-148a	CLIP-seq
MIRT1251751	hsa-miR-148b	CLIP-seq
MIRT1251752	hsa-miR-152	CLIP-seq
MIRT2301237	hsa-miR-1909	CLIP-seq
MIRT2301238	hsa-miR-24	CLIP-seq
MIRT2301239	hsa-miR-299-3p	CLIP-seq
MIRT1251786	hsa-miR-3184	CLIP-seq
MIRT2301240	hsa-miR-3187-5p	CLIP-seq
MIRT2301241	hsa-miR-3192	CLIP-seq
MIRT2301242	hsa-miR-3607-5p	CLIP-seq
MIRT2301243	hsa-miR-3616-3p	CLIP-seq
MIRT1251790	hsa-miR-423-5p	CLIP-seq
MIRT2301244	hsa-miR-4265	CLIP-seq
MIRT1251762	hsa-miR-4270	CLIP-seq
MIRT2301245	hsa-miR-4296	CLIP-seq
MIRT2301246	hsa-miR-4300	CLIP-seq
MIRT2301247	hsa-miR-4322	CLIP-seq
MIRT2301248	hsa-miR-4417	CLIP-seq
MIRT1251763	hsa-miR-4441	CLIP-seq
MIRT1251791	hsa-miR-4455	CLIP-seq
MIRT1251792	hsa-miR-4688	CLIP-seq
MIRT2301249	hsa-miR-4763-3p	CLIP-seq
MIRT1251776	hsa-miR-520f	CLIP-seq
MIRT2301250	hsa-miR-561	CLIP-seq
MIRT1251796	hsa-miR-609	CLIP-seq
MIRT2301251	hsa-miR-612	CLIP-seq
MIRT2301252	hsa-miR-642b	CLIP-seq
MIRT2301253	hsa-miR-9	CLIP-seq
MIRT2301254	hsa-miR-920	CLIP-seq
MIRT2301235	hsa-miR-1207-5p	CLIP-seq
MIRT2301236	hsa-miR-1285	CLIP-seq
MIRT2301237	hsa-miR-1909	CLIP-seq
MIRT2301239	hsa-miR-299-3p	CLIP-seq
MIRT2301240	hsa-miR-3187-5p	CLIP-seq
MIRT2301244	hsa-miR-4265	CLIP-seq
MIRT2301245	hsa-miR-4296	CLIP-seq
MIRT2301247	hsa-miR-4322	CLIP-seq
MIRT2301248	hsa-miR-4417	CLIP-seq
MIRT2392866	hsa-miR-4704-5p	CLIP-seq
MIRT2301249	hsa-miR-4763-3p	CLIP-seq
MIRT2392867	hsa-miR-4763-5p	CLIP-seq
MIRT2301251	hsa-miR-612	CLIP-seq
MIRT2301252	hsa-miR-642b	CLIP-seq
MIRT2597830	hsa-miR-1178	CLIP-seq
MIRT1251747	hsa-miR-1205	CLIP-seq
MIRT2301235	hsa-miR-1207-5p	CLIP-seq
MIRT2597831	hsa-miR-1224-3p	CLIP-seq
MIRT2597832	hsa-miR-1229	CLIP-seq
MIRT2597833	hsa-miR-1237	CLIP-seq
MIRT2597834	hsa-miR-1248	CLIP-seq
MIRT2597835	hsa-miR-1254	CLIP-seq
MIRT1251781	hsa-miR-1262	CLIP-seq
MIRT2301236	hsa-miR-1285	CLIP-seq
MIRT2597836	hsa-miR-1286	CLIP-seq
MIRT2597837	hsa-miR-1291	CLIP-seq
MIRT2597838	hsa-miR-1294	CLIP-seq
MIRT1251783	hsa-miR-1324	CLIP-seq
MIRT2301237	hsa-miR-1909	CLIP-seq
MIRT2597839	hsa-miR-1913	CLIP-seq
MIRT1251784	hsa-miR-2115	CLIP-seq
MIRT2597840	hsa-miR-218	CLIP-seq
MIRT2301239	hsa-miR-299-3p	CLIP-seq
MIRT2597841	hsa-miR-3065-5p	CLIP-seq
MIRT2597842	hsa-miR-3116	CLIP-seq
MIRT2597843	hsa-miR-3127-5p	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT2597844	hsa-miR-3136-3p	CLIP-seq
MIRT2597845	hsa-miR-3173-5p	CLIP-seq
MIRT2597846	hsa-miR-3176	CLIP-seq
MIRT2597847	hsa-miR-3183	CLIP-seq
MIRT1251786	hsa-miR-3184	CLIP-seq
MIRT2301240	hsa-miR-3187-5p	CLIP-seq
MIRT2301241	hsa-miR-3192	CLIP-seq
MIRT1251787	hsa-miR-3194-3p	CLIP-seq
MIRT2597848	hsa-miR-3194-5p	CLIP-seq
MIRT1251788	hsa-miR-3195	CLIP-seq
MIRT2597849	hsa-miR-320e	CLIP-seq
MIRT2597850	hsa-miR-324-3p	CLIP-seq
MIRT2597851	hsa-miR-326	CLIP-seq
MIRT2597852	hsa-miR-328	CLIP-seq
MIRT2597853	hsa-miR-330-5p	CLIP-seq
MIRT2597854	hsa-miR-339-3p	CLIP-seq
MIRT1251757	hsa-miR-34a	CLIP-seq
MIRT1251758	hsa-miR-34c-5p	CLIP-seq
MIRT2301243	hsa-miR-3616-3p	CLIP-seq
MIRT2597855	hsa-miR-3622a-3p	CLIP-seq
MIRT2597856	hsa-miR-3622b-3p	CLIP-seq
MIRT1251789	hsa-miR-3622b-5p	CLIP-seq
MIRT2597857	hsa-miR-3661	CLIP-seq
MIRT2597858	hsa-miR-3672	CLIP-seq
MIRT2597859	hsa-miR-3921	CLIP-seq
MIRT2597860	hsa-miR-3922-3p	CLIP-seq
MIRT1251790	hsa-miR-423-5p	CLIP-seq
MIRT2597861	hsa-miR-4254	CLIP-seq
MIRT2301244	hsa-miR-4265	CLIP-seq
MIRT2597862	hsa-miR-4268	CLIP-seq
MIRT2597863	hsa-miR-4287	CLIP-seq
MIRT2597864	hsa-miR-4292	CLIP-seq
MIRT2301245	hsa-miR-4296	CLIP-seq
MIRT2301246	hsa-miR-4300	CLIP-seq
MIRT2597865	hsa-miR-4308	CLIP-seq
MIRT2301247	hsa-miR-4322	CLIP-seq
MIRT2301248	hsa-miR-4417	CLIP-seq
MIRT2597866	hsa-miR-4419a	CLIP-seq
MIRT2597867	hsa-miR-4436b-3p	CLIP-seq
MIRT2597868	hsa-miR-4447	CLIP-seq
MIRT2597869	hsa-miR-4448	CLIP-seq
MIRT1251791	hsa-miR-4455	CLIP-seq
MIRT2597870	hsa-miR-4469	CLIP-seq
MIRT2597871	hsa-miR-4472	CLIP-seq
MIRT2597872	hsa-miR-4488	CLIP-seq
MIRT2597873	hsa-miR-4493	CLIP-seq
MIRT1251764	hsa-miR-449a	CLIP-seq
MIRT1251765	hsa-miR-449b	CLIP-seq
MIRT2597874	hsa-miR-4510	CLIP-seq
MIRT2597875	hsa-miR-4649-3p	CLIP-seq
MIRT2597876	hsa-miR-4650-5p	CLIP-seq
MIRT2597877	hsa-miR-4653-5p	CLIP-seq
MIRT2597878	hsa-miR-4667-3p	CLIP-seq
MIRT2597879	hsa-miR-4685-3p	CLIP-seq
MIRT1251792	hsa-miR-4688	CLIP-seq
MIRT1251793	hsa-miR-4691-5p	CLIP-seq
MIRT2597880	hsa-miR-4693-3p	CLIP-seq
MIRT2597881	hsa-miR-4697-5p	CLIP-seq
MIRT1251794	hsa-miR-4701-3p	CLIP-seq
MIRT2597882	hsa-miR-4707-5p	CLIP-seq
MIRT2597883	hsa-miR-4714-3p	CLIP-seq
MIRT2597884	hsa-miR-4716-3p	CLIP-seq
MIRT2597885	hsa-miR-4721	CLIP-seq
MIRT2597886	hsa-miR-4722-5p	CLIP-seq
MIRT2597887	hsa-miR-4723-3p	CLIP-seq
MIRT2597888	hsa-miR-4723-5p	CLIP-seq
MIRT1251767	hsa-miR-4728-5p	CLIP-seq
MIRT1251768	hsa-miR-4730	CLIP-seq
MIRT2597889	hsa-miR-4733-3p	CLIP-seq
MIRT2597890	hsa-miR-4749-3p	CLIP-seq
MIRT2301249	hsa-miR-4763-3p	CLIP-seq
MIRT2392867	hsa-miR-4763-5p	CLIP-seq
MIRT2597891	hsa-miR-4792	CLIP-seq
MIRT1251773	hsa-miR-486-3p	CLIP-seq
MIRT2597892	hsa-miR-490-3p	CLIP-seq
MIRT2597893	hsa-miR-492	CLIP-seq
MIRT2597894	hsa-miR-508-5p	CLIP-seq
MIRT1251774	hsa-miR-512-3p	CLIP-seq
MIRT1251795	hsa-miR-516a-3p	CLIP-seq
MIRT2597895	hsa-miR-539	CLIP-seq
MIRT2597896	hsa-miR-583	CLIP-seq
MIRT1251796	hsa-miR-609	CLIP-seq
MIRT2301251	hsa-miR-612	CLIP-seq
MIRT2597897	hsa-miR-619	CLIP-seq
MIRT2597898	hsa-miR-631	CLIP-seq
MIRT2597899	hsa-miR-636	CLIP-seq
MIRT2301252	hsa-miR-642b	CLIP-seq
MIRT1251797	hsa-miR-760	CLIP-seq
MIRT2597900	hsa-miR-766	CLIP-seq
MIRT2597901	hsa-miR-767-3p	CLIP-seq
MIRT2597902	hsa-miR-769-5p	CLIP-seq
MIRT2301254	hsa-miR-920	CLIP-seq
MIRT2597903	hsa-miR-942	CLIP-seq
MIRT1251799	hsa-miR-122	CLIP-seq
MIRT2688402	hsa-miR-1290	CLIP-seq
MIRT1251785	hsa-miR-3135b	CLIP-seq
MIRT1251802	hsa-miR-3652	CLIP-seq
MIRT1251805	hsa-miR-4430	CLIP-seq
MIRT2688403	hsa-miR-4654	CLIP-seq
MIRT2688404	hsa-miR-4769-5p	CLIP-seq
MIRT1251809	hsa-miR-541	CLIP-seq
MIRT1251810	hsa-miR-654-5p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CTNNB1	Unknown	17724465
JUN	Activation	18625220
RELA	Repression	14708613

124

Show/Hide all (124)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IPI	15001550
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001890	Process	Placenta development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IDA	12955147, 15001550, 35675826
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11551955
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	1333051
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	12955147
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005504	Function	Fatty acid binding	IEA
GO:0005515	Function	Protein binding	IPI	15722453, 23455924, 25416956, 32296183, 32814053, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	35675826
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	11551955
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006006	Process	Glucose metabolic process	NAS	15793256
GO:0006029	Process	Proteoglycan metabolic process	IEA
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	1333051
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	35675826
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	1333051
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	ISS
GO:0006629	Process	Lipid metabolic process	TAS	1333051
GO:0006631	Process	Fatty acid metabolic process	IBA
GO:0006635	Process	Fatty acid beta-oxidation	IEA
GO:0006635	Process	Fatty acid beta-oxidation	ISS
GO:0006635	Process	Fatty acid beta-oxidation	TAS	15192438, 15803109
GO:0006915	Process	Apoptotic process	IMP	12909723
GO:0007507	Process	Heart development	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0007566	Process	Embryo implantation	IEA
GO:0007566	Process	Embryo implantation	TAS	11551955
GO:0008203	Process	Cholesterol metabolic process	TAS	15192438
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008283	Process	Cell population proliferation	ISS
GO:0008289	Function	Lipid binding	IDA	12955147
GO:0008366	Process	Axon ensheathment	IEA
GO:0008366	Process	Axon ensheathment	ISS
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0009062	Process	Fatty acid catabolic process	TAS	15192438
GO:0009749	Process	Response to glucose	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010887	Process	Negative regulation of cholesterol storage	IBA
GO:0014823	Process	Response to activity	IEA
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IBA
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IEA
GO:0014912	Process	Negative regulation of smooth muscle cell migration	IEA
GO:0015908	Process	Fatty acid transport	IEA
GO:0015908	Process	Fatty acid transport	ISS
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IBA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	35675826
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IEA
GO:0033189	Process	Response to vitamin A	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0042060	Process	Wound healing	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043415	Process	Positive regulation of skeletal muscle tissue regeneration	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	NAS	10991946
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045684	Process	Positive regulation of epidermis development	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12955147
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046321	Process	Positive regulation of fatty acid oxidation	IEA
GO:0046697	Process	Decidualization	IEA
GO:0046697	Process	Decidualization	TAS	11551955
GO:0046872	Function	Metal ion binding	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IBA
GO:0051059	Function	NF-kappaB binding	IEA
GO:0051546	Process	Keratinocyte migration	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0070341	Process	Fat cell proliferation	IEA
GO:0070346	Process	Positive regulation of fat cell proliferation	IEA
GO:0070539	Function	Linoleic acid binding	IDA	10198642
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0097009	Process	Energy homeostasis	IBA
GO:0097009	Process	Energy homeostasis	IDA	35675826
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097190	Process	Apoptotic signaling pathway	IMP	11551955
GO:1902894	Process	Negative regulation of miRNA transcription	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	ISS
GO:1904659	Process	D-glucose transmembrane transport	NAS	15793256
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000288	Process	Positive regulation of myoblast proliferation	IEA

MIM	HGNC	e!Ensembl
600409	9235	ENSG00000112033

Q03181

Protein name

Peroxisome proliferator-activated receptor delta (PPAR-delta) (NUCI) (Nuclear hormone receptor 1) (NUC1) (Nuclear receptor subfamily 1 group C member 2) (Peroxisome proliferator-activated receptor beta) (PPAR-beta)

Protein function

Ligand-activated transcription factor key mediator of energy metabolism in adipose tissues (PubMed:35675826). Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty a

PDB

1GWX , 1Y0S , 2AWH , 2B50 , 2BAW , 2ENV , 2GWX , 2J14 , 2Q5G , 2XYJ , 2XYW , 2XYX , 2ZNP , 2ZNQ , 3D5F , 3DY6 , 3ET2 , 3GWX , 3GZ9 , 3OZ0 , 3PEQ , 3SP9 , 3TKM , 5U3Q , 5U3R , 5U3S , 5U3T , 5U3U , 5U3V , 5U3W , 5U3X , 5U3Y , 5U3Z , 5U40 , 5U41 , 5U42 , 5U43 , 5U44 , 5U45 , 5U46 , 5XMX , 5Y7X , 5ZXI , 6A6P , 7F80 , 7VWE , 7VWF , 7VWG , 7VWH , 7W0G , 7WGL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	72 → 140	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	236 → 422	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with maximal levels in placenta and skeletal muscle.

Sequence

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY

Sequence length

441

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS TYPE 2 ASSOCIATED CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES, ALCOHOLIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (207)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	22146481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	22146481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	21400612, 21704622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	17875695, 24763687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16344721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	19415698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30738994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	30607709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	27622388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31884472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30738994		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26578390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	26578390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19395102, 20842602, 26125839, 26346611, 26683793, 27283742, 28011212, 28128413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26964143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	32198386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	30602573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19395102, 20842602, 26125839, 26346611, 26683793, 27283742, 28011212, 28128413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20645257, 28128413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30227151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20624891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	24189640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18606951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18606951	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	LHGDN	11980898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	37418975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29160120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25776471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12009300, 23375374, 23722546, 23906790, 24464939, 29212212, 30204243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18054822, 23375374, 32238697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10555149, 11226285, 11228540, 16969348, 18054822, 18566335, 20424164, 23049921, 23208498, 23832539, 34921177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24189640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33941198, 35151320, 36396671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15978581, 18776129, 25043640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25968567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	20075336		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	20075336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	24125418, 27005447, 28287878, 29849537		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	19279199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	30607709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16966336, 25277864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16966336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16966336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28050012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30391747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12009300, 19347284, 19415698, 19436036, 19723884, 19935699, 21400612, 23041232, 23100225, 23368924, 23593291, 24610641, 24681603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12009300, 19436036, 21400612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10555149, 11087869, 17374999, 18720000, 19935699, 21765467, 23100225, 23821017, 23832539, 24391853, 24681603, 25713055, 26004416, 28128413, 30391747, 30868900, 30985693, 31239272 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10555149, 11226285, 16288226, 16969348, 19283612, 21765467, 23086933, 23832539, 24391853, 28128413, 30985693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12909723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17767717	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24011070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14641801, 20512451, 20645257, 26125839, 31340238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	14641801, 20512451, 20645257, 26125839, 26871769, 31340238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20645257, 26871769, 30429241, 31340238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	14641801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14641801, 20512451, 20645257, 22277050, 26125839, 31340238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28901183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	22879602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28267873, 29070884, 31038173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33683743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	22606335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16966336, 20200337, 23512374, 27634843, 29873587, 30605833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	23323702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16538490, 16966336, 18054822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16966336, 20200337, 23512374, 25311380, 27634843, 29873587, 30605833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22509365, 24359475, 25061733, 27655316, 28128413, 29776318, 34772419, 36051387, 38136661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29671030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16285997, 16804087, 18627005, 21300064, 21834910, 24359475, 26915488, 27005447, 28128413, 29776318, 30605833, 30739791, 31008686		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21458563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	26015769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31758977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	25043640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	18388689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	20200337, 24125418, 26683793, 28404991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32664384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	11228540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23943160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11228540, 23943160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	26613934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	18627005, 21725906, 22209682, 22824914, 30120929, 30814493		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	23851158		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	31839747	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	29908922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18497548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	21704622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32198386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	22606221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24011070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26642438, 29212711, 31625071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20107107, 30129179, 30227329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	32664384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	25873088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	20645257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	17637826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29914579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29914579	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27881385, 29914579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	22509365, 29776318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28467934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	29720336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	26922534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31008686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	22606335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714, 22368174, 25061733, 31839747, 35205333, 36051387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23512374, 26346611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	31426866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	22277050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25734857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	31758977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipidoses	Lipidoses	Pubtator	31839747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoidosis	Lipoidosis	BEFREE	31839747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17178883, 25116592, 28584024, 31744516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	28992755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15978581, 18390835, 18566335, 18776129, 18950674, 19654299, 25043640, 33637678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18566335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28242713, 29208022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32566688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28242713, 29208022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28242713, 29208022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28242713, 29208022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12009300, 23375374, 23906790, 24464939, 29212212, 30204243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23943160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15978581, 18776129, 25043640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25968567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15126355, 26852954, 29187400, 29541400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	19748995, 21159610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	24203162, 29729928, 31062422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15890232, 23907334, 31796534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17374999, 19660859, 19723884, 20221637, 21531809, 21765467, 23208498, 23598720, 25043640, 25277864, 27916645, 28097239, 28419191, 28881566, 29187400 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12009300, 19347284, 19415698, 19436036, 19723884, 19935699, 21400612, 23041232, 23100225, 23368924, 23593291, 24610641, 24681603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12009300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23906790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	30607709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18054822, 19383853	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	28962521, 30098172		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	28962521		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28267873, 29070884, 31038173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	16083348, 17431579, 20200337, 28185575, 28320959, 28467934, 29558390, 29849537, 30827999, 31635041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	17324937, 30827999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	18054822, 19639232, 24060638, 26673968, 28128413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15001574, 16953259, 21458563, 24060638, 26673968, 28404991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30778379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35053305, 37048084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	29458111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29458111, 30258544, 31223463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	31767149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	20075336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28621328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30002625, 30982495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17183061, 17374999, 18720000, 19436036, 21046127, 23906790, 24213576, 24464939, 24610641, 24763687, 24898257, 25713055, 25968567, 29187400, 29367760, 30204243, 31150647, 31842402 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23874790, 27996177, 31063584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23874790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17324937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29212711		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	24213576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	24213576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	16574099, 29289645		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23605066, 26668503, 29289645, 29558390, 29954129, 30814493, 31523999, 31839747		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16061473, 18776129, 19654299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	16574099, 29289645		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25474087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	15001574, 16966336, 17431579, 18627005, 18657264, 19512923, 20200337, 23041232, 23273766, 26073637, 26346611, 26673968, 26915488, 27844208, 28098353 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	16168052, 20176998		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16966336, 18054822, 18379566, 18657264, 19818126, 21834910, 22990076, 23039238, 23109900, 23545576, 25670728, 26073637, 26673968, 28128413, 32078194, 36297109 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26694359	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	26073637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	25670728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	38212774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25968567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11943708, 18349831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24294133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23500098, 29885849, 30612307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	20864405, 21245421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30170078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Hyperplastic Primary Vitreous	Persistent Hyperplastic Primary Vitreous	BEFREE	31462148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20840271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15126355, 26852954, 29187400, 29541400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17637826, 22606335, 28542811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	17637826	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	18305567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33683743	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	23607100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17459894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	19935699, 21531809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	16361076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	13130515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	28737528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28440451, 29697010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	19748995, 21159610		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26602520	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15811118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24203162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18627005, 21725906, 22209682, 22824914, 25474087, 26668503, 30120929, 30814493, 31839747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	23851158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15890232, 23907334, 31796534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23907334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	29596381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18701481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18701481	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35393513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	27856609, 30620754, 31144304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	23607100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	29145845		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	29145845		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPARD (peroxisome proliferator activated receptor delta)