CA14 (carbonic anhydrase 14)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 23632
Gene name Carbonic anhydrase 14
Gene symbol CA14
Synonyms (NCBI Gene)
CAXiV
Chromosome 1
Chromosome location 1q21.2
Summary Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption,
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT017187 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004089 Function Carbonate dehydratase activity IBA
GO:0004089 Function Carbonate dehydratase activity IEA
GO:0004089 Function Carbonate dehydratase activity TAS 10512682
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604832 1372 ENSG00000118298
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9ULX7
Protein name Carbonic anhydrase 14 (EC 4.2.1.1) (Carbonate dehydratase XIV) (Carbonic anhydrase XIV) (CA-XIV)
Protein function Reversible hydration of carbon dioxide.
PDB 4LU3 , 5CJF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00194 Carb_anhydrase 21 → 277 Eukaryotic-type carbonic anhydrase Domain
Tissue specificity TISSUE SPECIFICITY: High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
Sequence 
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG
SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH
LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ
LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Sequence length 337
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Nitrogen metabolism Reversible hydration of carbon dioxide
Metabolic pathways  
Sort by:
CA5B 2 shared pathwaysNitrogen metabolism, Reversible hydration of carbon dioxide Related via 2 shared pathways including Nitrogen metabolism, Reversible hydration of carbon dioxide. CA13 2 shared pathwaysNitrogen metabolism, Reversible hydration of carbon dioxide Related via 2 shared pathways including Nitrogen metabolism, Reversible hydration of carbon dioxide. CA3 2 shared pathwaysNitrogen metabolism, Reversible hydration of carbon dioxide Related via 2 shared pathways including Nitrogen metabolism, Reversible hydration of carbon dioxide. CA5A 2 shared pathwaysNitrogen metabolism, Reversible hydration of carbon dioxide Related via 2 shared pathways including Nitrogen metabolism, Reversible hydration of carbon dioxide. CA6 2 shared pathwaysNitrogen metabolism, Reversible hydration of carbon dioxide Related via 2 shared pathways including Nitrogen metabolism, Reversible hydration of carbon dioxide.
Fatty liver Linked via 1 of 5 related genesCA3 Fatty liver, alcoholic Linked via 1 of 5 related genesCA3 Obesity Linked via 1 of 5 related genesCA3 Alzheimer disease Linked via 1 of 5 related genesCA5A Carbonic anhydrase deficiency Linked via 1 of 5 related genesCA5A