Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10094
Gene name	Actin related protein 2/3 complex subunit 3
Gene symbol	ARPC3
Synonyms (NCBI Gene)	ARC21p21-Arc
Chromosome	12
Chromosome location	12q24.11
Summary	This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have

159 Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020984	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT050237	hsa-miR-25-3p	CLASH	23622248
MIRT570301	hsa-miR-8084	PAR-CLIP	20371350
MIRT570299	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT570298	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT570297	hsa-miR-429	PAR-CLIP	20371350
MIRT570296	hsa-miR-4779	PAR-CLIP	20371350
MIRT570295	hsa-miR-6782-5p	PAR-CLIP	20371350
MIRT570294	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT570293	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT570292	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT570291	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT570290	hsa-miR-5194	PAR-CLIP	20371350
MIRT570289	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT570288	hsa-miR-765	PAR-CLIP	20371350
MIRT570287	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT570286	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT570284	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT570285	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT570283	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT570282	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT570281	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT570280	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT570279	hsa-miR-4651	PAR-CLIP	20371350
MIRT570278	hsa-miR-608	PAR-CLIP	20371350
MIRT570277	hsa-miR-6756-5p	PAR-CLIP	20371350
MIRT570275	hsa-miR-6766-5p	PAR-CLIP	20371350
MIRT570276	hsa-miR-1233-5p	PAR-CLIP	20371350
MIRT570274	hsa-miR-6778-5p	PAR-CLIP	20371350
MIRT570273	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT570272	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT570271	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT570270	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT570269	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT570268	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT570267	hsa-miR-3689c	PAR-CLIP	20371350
MIRT570266	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT570265	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT570264	hsa-miR-4534	PAR-CLIP	20371350
MIRT020984	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT020984	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT570301	hsa-miR-8084	PAR-CLIP	20371350
MIRT570299	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT570298	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT570297	hsa-miR-429	PAR-CLIP	20371350
MIRT570296	hsa-miR-4779	PAR-CLIP	20371350
MIRT570295	hsa-miR-6782-5p	PAR-CLIP	20371350
MIRT570294	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT570293	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT570292	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT570291	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT570290	hsa-miR-5194	PAR-CLIP	20371350
MIRT570289	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT570288	hsa-miR-765	PAR-CLIP	20371350
MIRT570287	hsa-miR-1249-5p	PAR-CLIP	20371350
MIRT570286	hsa-miR-6797-5p	PAR-CLIP	20371350
MIRT570284	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT570285	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT570283	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT570282	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT570281	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT570280	hsa-miR-6799-5p	PAR-CLIP	20371350
MIRT570279	hsa-miR-4651	PAR-CLIP	20371350
MIRT570278	hsa-miR-608	PAR-CLIP	20371350
MIRT570277	hsa-miR-6756-5p	PAR-CLIP	20371350
MIRT570275	hsa-miR-6766-5p	PAR-CLIP	20371350
MIRT570276	hsa-miR-1233-5p	PAR-CLIP	20371350
MIRT570274	hsa-miR-6778-5p	PAR-CLIP	20371350
MIRT570273	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT570272	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT570271	hsa-miR-1273h-5p	PAR-CLIP	20371350
MIRT570270	hsa-miR-30b-3p	PAR-CLIP	20371350
MIRT570269	hsa-miR-3689a-3p	PAR-CLIP	20371350
MIRT570268	hsa-miR-3689b-3p	PAR-CLIP	20371350
MIRT570267	hsa-miR-3689c	PAR-CLIP	20371350
MIRT570266	hsa-miR-6779-5p	PAR-CLIP	20371350
MIRT570265	hsa-miR-6780a-5p	PAR-CLIP	20371350
MIRT570264	hsa-miR-4534	PAR-CLIP	20371350
MIRT799753	hsa-miR-1	CLIP-seq
MIRT799754	hsa-miR-1297	CLIP-seq
MIRT799755	hsa-miR-1305	CLIP-seq
MIRT799756	hsa-miR-155	CLIP-seq
MIRT799757	hsa-miR-206	CLIP-seq
MIRT799758	hsa-miR-26a	CLIP-seq
MIRT799759	hsa-miR-26b	CLIP-seq
MIRT799760	hsa-miR-298	CLIP-seq
MIRT799761	hsa-miR-3158-5p	CLIP-seq
MIRT799762	hsa-miR-335	CLIP-seq
MIRT799763	hsa-miR-3617	CLIP-seq
MIRT799764	hsa-miR-3647-3p	CLIP-seq
MIRT799765	hsa-miR-3673	CLIP-seq
MIRT799766	hsa-miR-4282	CLIP-seq
MIRT799767	hsa-miR-4465	CLIP-seq
MIRT799768	hsa-miR-4477a	CLIP-seq
MIRT799769	hsa-miR-4795-3p	CLIP-seq
MIRT799770	hsa-miR-498	CLIP-seq
MIRT799771	hsa-miR-513a-3p	CLIP-seq
MIRT799772	hsa-miR-518e	CLIP-seq
MIRT799773	hsa-miR-548u	CLIP-seq
MIRT799774	hsa-miR-556-3p	CLIP-seq
MIRT799775	hsa-miR-613	CLIP-seq
MIRT799776	hsa-miR-641	CLIP-seq
MIRT1936263	hsa-miR-1273d	CLIP-seq
MIRT799760	hsa-miR-298	CLIP-seq
MIRT799761	hsa-miR-3158-5p	CLIP-seq
MIRT1936264	hsa-miR-3161	CLIP-seq
MIRT1936265	hsa-miR-3620	CLIP-seq
MIRT799764	hsa-miR-3647-3p	CLIP-seq
MIRT1936266	hsa-miR-3671	CLIP-seq
MIRT799766	hsa-miR-4282	CLIP-seq
MIRT799768	hsa-miR-4477a	CLIP-seq
MIRT1936267	hsa-miR-4762-5p	CLIP-seq
MIRT1936268	hsa-miR-4780	CLIP-seq
MIRT799771	hsa-miR-513a-3p	CLIP-seq
MIRT1936269	hsa-miR-607	CLIP-seq
MIRT2176106	hsa-miR-1236	CLIP-seq
MIRT799754	hsa-miR-1297	CLIP-seq
MIRT799755	hsa-miR-1305	CLIP-seq
MIRT799758	hsa-miR-26a	CLIP-seq
MIRT799759	hsa-miR-26b	CLIP-seq
MIRT2176107	hsa-miR-3163	CLIP-seq
MIRT2176108	hsa-miR-3182	CLIP-seq
MIRT799762	hsa-miR-335	CLIP-seq
MIRT799763	hsa-miR-3617	CLIP-seq
MIRT799764	hsa-miR-3647-3p	CLIP-seq
MIRT2176109	hsa-miR-3686	CLIP-seq
MIRT799766	hsa-miR-4282	CLIP-seq
MIRT799767	hsa-miR-4465	CLIP-seq
MIRT2176110	hsa-miR-4742-3p	CLIP-seq
MIRT2176111	hsa-miR-4768-5p	CLIP-seq
MIRT799770	hsa-miR-498	CLIP-seq
MIRT799771	hsa-miR-513a-3p	CLIP-seq
MIRT799773	hsa-miR-548u	CLIP-seq
MIRT2176112	hsa-miR-568	CLIP-seq
MIRT799776	hsa-miR-641	CLIP-seq
MIRT2176113	hsa-miR-942	CLIP-seq
MIRT799753	hsa-miR-1	CLIP-seq
MIRT2479473	hsa-miR-1224-3p	CLIP-seq
MIRT2479474	hsa-miR-1260	CLIP-seq
MIRT2479475	hsa-miR-1260b	CLIP-seq
MIRT2479476	hsa-miR-1280	CLIP-seq
MIRT2479477	hsa-miR-150	CLIP-seq
MIRT799756	hsa-miR-155	CLIP-seq
MIRT799757	hsa-miR-206	CLIP-seq
MIRT799760	hsa-miR-298	CLIP-seq
MIRT799761	hsa-miR-3158-5p	CLIP-seq
MIRT799764	hsa-miR-3647-3p	CLIP-seq
MIRT1936266	hsa-miR-3671	CLIP-seq
MIRT799765	hsa-miR-3673	CLIP-seq
MIRT799766	hsa-miR-4282	CLIP-seq
MIRT799768	hsa-miR-4477a	CLIP-seq
MIRT2479478	hsa-miR-4713-5p	CLIP-seq
MIRT799769	hsa-miR-4795-3p	CLIP-seq
MIRT799771	hsa-miR-513a-3p	CLIP-seq
MIRT799772	hsa-miR-518e	CLIP-seq
MIRT2479479	hsa-miR-532-3p	CLIP-seq
MIRT799774	hsa-miR-556-3p	CLIP-seq
MIRT1936269	hsa-miR-607	CLIP-seq
MIRT799775	hsa-miR-613	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	IDA	11741539
GO:0005200	Function	Structural constituent of cytoskeleton	TAS	9230079
GO:0005515	Function	Protein binding	IPI	11162547, 24981860, 25416956, 32296183, 33961781, 35271311, 36217029, 36217030
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005885	Component	Arp2/3 protein complex	IBA
GO:0005885	Component	Arp2/3 protein complex	IDA	11741539
GO:0005885	Component	Arp2/3 protein complex	IEA
GO:0005885	Component	Arp2/3 protein complex	TAS	9230079
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0015629	Component	Actin cytoskeleton	TAS	9230079
GO:0016020	Component	Membrane	HDA	19946888
GO:0030027	Component	Lamellipodium	IDA	9230079
GO:0030027	Component	Lamellipodium	IEA
GO:0030833	Process	Regulation of actin filament polymerization	IEA
GO:0031252	Component	Cell leading edge	IEA
GO:0031941	Component	Filamentous actin	IEA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IBA
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IDA	11741539
GO:0034314	Process	Arp2/3 complex-mediated actin nucleation	IEA
GO:0035861	Component	Site of double-strand break	ISS
GO:0042995	Component	Cell projection	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	11741539
GO:0061850	Component	Growth cone leading edge	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070358	Process	Actin polymerization-dependent cell motility	TAS	9230079
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA

MIM	HGNC	e!Ensembl
604225	706	ENSG00000111229

O15145

Protein name

Actin-related protein 2/3 complex subunit 3 (Arp2/3 complex 21 kDa subunit) (p21-ARC)

Protein function

Component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF) (PubMed:9230079). The Arp2/3 complex mediates the formation of branched actin networks in the cytopl

PDB

6UHC , 6YW6 , 6YW7 , 8P94

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04062	P21-Arc	1 → 173	ARP2/3 complex ARPC3 (21 kDa) subunit	Family

Sequence

MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ

Sequence length

178

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Endocytosis	Regulation of actin dynamics for phagocytic cup formation
Tight junction	EPHB-mediated forward signaling
Fc gamma R-mediated phagocytosis	RHO GTPases Activate WASPs and WAVEs
Regulation of actin cytoskeleton	Clathrin-mediated endocytosis
Bacterial invasion of epithelial cells	FCGR3A-mediated phagocytosis
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33960941	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27055012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40616392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Porokeratosis	Porokeratosis	BEFREE	19615027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Porokeratosis of Mibelli	Porokeratosis	BEFREE	19615027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Porokeratosis, Disseminated Superficial Actinic	Porokeratosis	BEFREE	15928614		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ARPC5	[]	14	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection","Regulation of actin dynamics for phagocytic cup formation","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
ARPC4	[]	14	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection","Regulation of actin dynamics for phagocytic cup formation","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
ACTR3	[]	14	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection","Regulation of actin dynamics for phagocytic cup formation","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
ACTR2	[]	14	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection","Regulation of actin dynamics for phagocytic cup formation","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]
ARPC2	[]	14	["Endocytosis","Tight junction","Fc gamma R-mediated phagocytosis","Regulation of actin cytoskeleton","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection","Yersinia infection","Regulation of actin dynamics for phagocytic cup formation","RHO GTPases Activate WASPs and WAVEs","FCGR3A-mediated phagocytosis"]	[]

ARPC3 (actin related protein 2/3 complex subunit 3)

Bookmark This Gene