Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51433
Gene name	Anaphase promoting complex subunit 5
Gene symbol	ANAPC5
Synonyms (NCBI Gene)	APC5
Chromosome	12
Chromosome location	12q24.31
Summary	This gene encodes a tetratricopeptide repeat-containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins f

57 Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022451	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT049952	hsa-miR-30a-5p	CLASH	23622248
MIRT048874	hsa-miR-93-5p	CLASH	23622248
MIRT047361	hsa-miR-34a-5p	CLASH	23622248
MIRT038955	hsa-miR-26b-3p	CLASH	23622248
MIRT036395	hsa-miR-1227-3p	CLASH	23622248
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781064	hsa-miR-3130-3p	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781074	hsa-miR-4793-3p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq
MIRT781077	hsa-miR-597	CLIP-seq
MIRT1930532	hsa-miR-214	CLIP-seq
MIRT1930533	hsa-miR-2964a-5p	CLIP-seq
MIRT781064	hsa-miR-3130-3p	CLIP-seq
MIRT1930534	hsa-miR-3619-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT1930535	hsa-miR-3909	CLIP-seq
MIRT1930536	hsa-miR-4530	CLIP-seq
MIRT1930537	hsa-miR-4690-3p	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781074	hsa-miR-4793-3p	CLIP-seq
MIRT1930538	hsa-miR-761	CLIP-seq
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IDA	18445686, 21241890
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	16364912
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	18445686
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	21241890
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IBA
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IBA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
606948	15713	ENSG00000089053

Q9UJX4

Protein name

Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit

PDB

4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12862	ANAPC5	254 → 354	Anaphase-promoting complex subunit 5	Family
PF12862	ANAPC5	398 → 495	Anaphase-promoting complex subunit 5	Family

Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA
LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDK
GRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Sequence length

755

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cell cycle	Inactivation of APC/C via direct inhibition of the APC/C complex
Oocyte meiosis	APC/C:Cdc20 mediated degradation of Cyclin B
Ubiquitin mediated proteolysis	Autodegradation of Cdh1 by Cdh1:APC/C
IL-17 signaling pathway	APC/C:Cdc20 mediated degradation of Securin
Progesterone-mediated oocyte maturation	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Human T-cell leukemia virus 1 infection	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
	Regulation of APC/C activators between G1/S and early anaphase
	APC/C:Cdc20 mediated degradation of mitotic proteins
	Phosphorylation of the APC/C
	APC-Cdc20 mediated degradation of Nek2A
	Separation of Sister Chromatids
	Senescence-Associated Secretory Phenotype (SASP)
	CDK-mediated phosphorylation and removal of Cdc6
	Transcriptional Regulation by VENTX
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANAPC5-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31383941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28731177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ANAPC10	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
ANAPC16	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
CDC26	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
ANAPC15	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
ANAPC2	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]

ANAPC5 (anaphase promoting complex subunit 5)

Save This Analysis