Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51529
Gene name	Anaphase promoting complex subunit 11
Gene symbol	ANAPC11
Synonyms (NCBI Gene)	APC11Apc11pHSPC214
Chromosome	17
Chromosome location	17q25.3

30 Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048482	hsa-miR-100-5p	CLASH	23622248
MIRT780745	hsa-miR-1244	CLIP-seq
MIRT780746	hsa-miR-1245	CLIP-seq
MIRT780747	hsa-miR-1261	CLIP-seq
MIRT780748	hsa-miR-1266	CLIP-seq
MIRT780749	hsa-miR-129-3p	CLIP-seq
MIRT780750	hsa-miR-1301	CLIP-seq
MIRT780751	hsa-miR-1912	CLIP-seq
MIRT780752	hsa-miR-3692	CLIP-seq
MIRT780753	hsa-miR-4269	CLIP-seq
MIRT780754	hsa-miR-4470	CLIP-seq
MIRT780755	hsa-miR-4518	CLIP-seq
MIRT780756	hsa-miR-4660	CLIP-seq
MIRT780757	hsa-miR-4684-3p	CLIP-seq
MIRT780758	hsa-miR-495	CLIP-seq
MIRT780759	hsa-miR-5047	CLIP-seq
MIRT780760	hsa-miR-5096	CLIP-seq
MIRT780761	hsa-miR-766	CLIP-seq
MIRT1930489	hsa-miR-338-3p	CLIP-seq
MIRT1930490	hsa-miR-4530	CLIP-seq
MIRT780761	hsa-miR-766	CLIP-seq
MIRT780747	hsa-miR-1261	CLIP-seq
MIRT780760	hsa-miR-5096	CLIP-seq
MIRT1930491	hsa-miR-548n	CLIP-seq
MIRT1930492	hsa-miR-548t	CLIP-seq
MIRT780750	hsa-miR-1301	CLIP-seq
MIRT780752	hsa-miR-3692	CLIP-seq
MIRT780756	hsa-miR-4660	CLIP-seq
MIRT780757	hsa-miR-4684-3p	CLIP-seq
MIRT780759	hsa-miR-5047	CLIP-seq

44 Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	TAS	11739784
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	11739784
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	11739784, 16364912, 21926987
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	11739784
GO:0016567	Process	Protein ubiquitination	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	18485873, 29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IEA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	39880951
GO:0031461	Component	Cullin-RING ubiquitin ligase complex	IEA
GO:0034450	Function	Ubiquitin-ubiquitin ligase activity	IDA	10230407
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IBA
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IDA	11739784
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	10230407, 18485873
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0097602	Function	Cullin family protein binding	IBA
GO:0097602	Function	Cullin family protein binding	IDA	10230407
GO:0097602	Function	Cullin family protein binding	IEA
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
614534	14452	ENSG00000141552

Q9NYG5

Protein name

Anaphase-promoting complex subunit 11 (APC11) (Cyclosome subunit 11) (Hepatocellular carcinoma-associated RING finger protein)

Protein function

Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell c

PDB

2MT5 , 4R2Y , 4UI9 , 5A31 , 5G04 , 5G05 , 5JG6 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12861	zf-ANAPC11	1 → 84	Anaphase-promoting complex subunit 11 RING-H2 finger	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in skeletal muscle and heart; in moderate levels in brain, kidney, and liver; and at low levels in colon, thymus, spleen, small intestine, placenta, lung and peripheral blood leukocyte. {ECO:0000269|PubMed:1157

Sequence

MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE

Sequence length

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cell cycle	Inactivation of APC/C via direct inhibition of the APC/C complex
Oocyte meiosis	APC/C:Cdc20 mediated degradation of Cyclin B
Ubiquitin mediated proteolysis	Autodegradation of Cdh1 by Cdh1:APC/C
Progesterone-mediated oocyte maturation	APC/C:Cdc20 mediated degradation of Securin
Human T-cell leukemia virus 1 infection	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
	Regulation of APC/C activators between G1/S and early anaphase
	APC/C:Cdc20 mediated degradation of mitotic proteins
	Phosphorylation of the APC/C
	APC-Cdc20 mediated degradation of Nek2A
	Separation of Sister Chromatids
	Senescence-Associated Secretory Phenotype (SASP)
	CDK-mediated phosphorylation and removal of Cdc6
	Transcriptional Regulation by VENTX
	Antigen processing: Ubiquitination & Proteasome degradation

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
ANAPC10	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
ANAPC16	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
CDC26	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
ANAPC15	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]
ANAPC2	[]	20	["Cell cycle","Oocyte meiosis","Ubiquitin mediated proteolysis","Progesterone-mediated oocyte maturation","Human T-cell leukemia virus 1 infection","Separation of Sister Chromatids","Regulation of APC\/C activators between G1\/S and early anaphase","Senescence-Associated Secretory Phenotype (SASP)","CDK-mediated phosphorylation and removal of Cdc6","Autodegradation of Cdh1 by Cdh1:APC\/C","APC\/C:Cdc20 mediated degradation of Securin","APC\/C:Cdh1 mediated degradation of Cdc20 and other APC\/C:Cdh1 targeted proteins in late mitosis\/early G1"]	[]

ANAPC11 (anaphase promoting complex subunit 11)

Bookmark This Gene