Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	23456
Gene name	ATP binding cassette subfamily B member 10
Gene symbol	ABCB10
Synonyms (NCBI Gene)	EST20237M-ABC2MTABC2
Chromosome	1
Chromosome location	1q42.13
Summary	The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinc

141

Show/Hide all (141)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024476	hsa-miR-215-5p	Microarray	19074876
MIRT026891	hsa-miR-192-5p	Microarray	19074876
MIRT028616	hsa-miR-30a-5p	Proteomics	18668040
MIRT030557	hsa-miR-24-3p	Microarray	19748357
MIRT032488	hsa-let-7b-5p	Proteomics	18668040
MIRT758067	hsa-miR-1206	CLIP-seq
MIRT758068	hsa-miR-1208	CLIP-seq
MIRT758069	hsa-miR-1238	CLIP-seq
MIRT758070	hsa-miR-1267	CLIP-seq
MIRT758071	hsa-miR-1279	CLIP-seq
MIRT758072	hsa-miR-1323	CLIP-seq
MIRT758073	hsa-miR-141	CLIP-seq
MIRT758074	hsa-miR-146a	CLIP-seq
MIRT758075	hsa-miR-146b-5p	CLIP-seq
MIRT758076	hsa-miR-200a	CLIP-seq
MIRT758077	hsa-miR-203	CLIP-seq
MIRT758078	hsa-miR-2052	CLIP-seq
MIRT758079	hsa-miR-2276	CLIP-seq
MIRT758080	hsa-miR-3148	CLIP-seq
MIRT758081	hsa-miR-3153	CLIP-seq
MIRT758082	hsa-miR-3156-5p	CLIP-seq
MIRT758083	hsa-miR-3159	CLIP-seq
MIRT758084	hsa-miR-329	CLIP-seq
MIRT758085	hsa-miR-33a	CLIP-seq
MIRT758086	hsa-miR-33b	CLIP-seq
MIRT758087	hsa-miR-362-3p	CLIP-seq
MIRT758088	hsa-miR-3662	CLIP-seq
MIRT758089	hsa-miR-3941	CLIP-seq
MIRT758090	hsa-miR-3978	CLIP-seq
MIRT758091	hsa-miR-4330	CLIP-seq
MIRT758092	hsa-miR-4434	CLIP-seq
MIRT758093	hsa-miR-4457	CLIP-seq
MIRT758094	hsa-miR-450b-5p	CLIP-seq
MIRT758095	hsa-miR-4516	CLIP-seq
MIRT758096	hsa-miR-451b	CLIP-seq
MIRT758097	hsa-miR-452	CLIP-seq
MIRT758098	hsa-miR-4531	CLIP-seq
MIRT758099	hsa-miR-4652-3p	CLIP-seq
MIRT758100	hsa-miR-4659a-5p	CLIP-seq
MIRT758101	hsa-miR-4659b-5p	CLIP-seq
MIRT758102	hsa-miR-466	CLIP-seq
MIRT758103	hsa-miR-4668-5p	CLIP-seq
MIRT758104	hsa-miR-4672	CLIP-seq
MIRT758105	hsa-miR-4676-3p	CLIP-seq
MIRT758106	hsa-miR-4772-3p	CLIP-seq
MIRT758107	hsa-miR-4773	CLIP-seq
MIRT758108	hsa-miR-4778-5p	CLIP-seq
MIRT758109	hsa-miR-507	CLIP-seq
MIRT758110	hsa-miR-526b	CLIP-seq
MIRT758111	hsa-miR-544	CLIP-seq
MIRT758112	hsa-miR-548o	CLIP-seq
MIRT758113	hsa-miR-557	CLIP-seq
MIRT758114	hsa-miR-578	CLIP-seq
MIRT758115	hsa-miR-580	CLIP-seq
MIRT758116	hsa-miR-589	CLIP-seq
MIRT758117	hsa-miR-603	CLIP-seq
MIRT758118	hsa-miR-607	CLIP-seq
MIRT758119	hsa-miR-653	CLIP-seq
MIRT758120	hsa-miR-656	CLIP-seq
MIRT1923580	hsa-miR-1304	CLIP-seq
MIRT1923581	hsa-miR-1827	CLIP-seq
MIRT1923582	hsa-miR-183	CLIP-seq
MIRT1923583	hsa-miR-2054	CLIP-seq
MIRT1923584	hsa-miR-3120-3p	CLIP-seq
MIRT1923585	hsa-miR-3133	CLIP-seq
MIRT758083	hsa-miR-3159	CLIP-seq
MIRT1923586	hsa-miR-3682-5p	CLIP-seq
MIRT758093	hsa-miR-4457	CLIP-seq
MIRT758097	hsa-miR-452	CLIP-seq
MIRT758105	hsa-miR-4676-3p	CLIP-seq
MIRT1923587	hsa-miR-4760-3p	CLIP-seq
MIRT1923588	hsa-miR-513a-3p	CLIP-seq
MIRT758110	hsa-miR-526b	CLIP-seq
MIRT1923589	hsa-miR-545	CLIP-seq
MIRT758114	hsa-miR-578	CLIP-seq
MIRT758068	hsa-miR-1208	CLIP-seq
MIRT758069	hsa-miR-1238	CLIP-seq
MIRT758070	hsa-miR-1267	CLIP-seq
MIRT2165043	hsa-miR-128	CLIP-seq
MIRT758073	hsa-miR-141	CLIP-seq
MIRT2165044	hsa-miR-193a-3p	CLIP-seq
MIRT2165045	hsa-miR-193b	CLIP-seq
MIRT758076	hsa-miR-200a	CLIP-seq
MIRT758078	hsa-miR-2052	CLIP-seq
MIRT2165046	hsa-miR-214	CLIP-seq
MIRT758079	hsa-miR-2276	CLIP-seq
MIRT2165047	hsa-miR-3163	CLIP-seq
MIRT2165048	hsa-miR-3176	CLIP-seq
MIRT2165049	hsa-miR-3619-5p	CLIP-seq
MIRT758088	hsa-miR-3662	CLIP-seq
MIRT2165050	hsa-miR-3921	CLIP-seq
MIRT2165051	hsa-miR-3922-3p	CLIP-seq
MIRT758089	hsa-miR-3941	CLIP-seq
MIRT2165052	hsa-miR-4272	CLIP-seq
MIRT758091	hsa-miR-4330	CLIP-seq
MIRT2165053	hsa-miR-4474-5p	CLIP-seq
MIRT758097	hsa-miR-452	CLIP-seq
MIRT758099	hsa-miR-4652-3p	CLIP-seq
MIRT2165054	hsa-miR-4653-5p	CLIP-seq
MIRT758102	hsa-miR-466	CLIP-seq
MIRT758104	hsa-miR-4672	CLIP-seq
MIRT758105	hsa-miR-4676-3p	CLIP-seq
MIRT2165055	hsa-miR-4682	CLIP-seq
MIRT2165056	hsa-miR-4690-5p	CLIP-seq
MIRT2165057	hsa-miR-4714-3p	CLIP-seq
MIRT2165058	hsa-miR-4742-5p	CLIP-seq
MIRT758106	hsa-miR-4772-3p	CLIP-seq
MIRT758108	hsa-miR-4778-5p	CLIP-seq
MIRT2165059	hsa-miR-509-3p	CLIP-seq
MIRT758111	hsa-miR-544	CLIP-seq
MIRT2165060	hsa-miR-548g	CLIP-seq
MIRT758114	hsa-miR-578	CLIP-seq
MIRT2165061	hsa-miR-593	CLIP-seq
MIRT2165062	hsa-miR-761	CLIP-seq
MIRT2383740	hsa-miR-1257	CLIP-seq
MIRT2383741	hsa-miR-3607-5p	CLIP-seq
MIRT2383742	hsa-miR-485-3p	CLIP-seq
MIRT2383743	hsa-miR-548k	CLIP-seq
MIRT2425876	hsa-miR-4477a	CLIP-seq
MIRT2425877	hsa-miR-944	CLIP-seq
MIRT2467006	hsa-miR-1179	CLIP-seq
MIRT758070	hsa-miR-1267	CLIP-seq
MIRT2467007	hsa-miR-181a	CLIP-seq
MIRT2467008	hsa-miR-181b	CLIP-seq
MIRT2467009	hsa-miR-181c	CLIP-seq
MIRT2467010	hsa-miR-181d	CLIP-seq
MIRT1923582	hsa-miR-183	CLIP-seq
MIRT2467011	hsa-miR-323b-5p	CLIP-seq
MIRT2467012	hsa-miR-3672	CLIP-seq
MIRT2467013	hsa-miR-4262	CLIP-seq
MIRT2467014	hsa-miR-4470	CLIP-seq
MIRT758099	hsa-miR-4652-3p	CLIP-seq
MIRT2467015	hsa-miR-4670-3p	CLIP-seq
MIRT758108	hsa-miR-4778-5p	CLIP-seq
MIRT758114	hsa-miR-578	CLIP-seq
MIRT2467016	hsa-miR-651	CLIP-seq
MIRT758119	hsa-miR-653	CLIP-seq
MIRT2467006	hsa-miR-1179	CLIP-seq
MIRT1923582	hsa-miR-183	CLIP-seq
MIRT2467011	hsa-miR-323b-5p	CLIP-seq
MIRT2467014	hsa-miR-4470	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	25063848, 30765471, 36836934
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	22655043
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006783	Process	Heme biosynthetic process	IEA
GO:0006783	Process	Heme biosynthetic process	ISS
GO:0006839	Process	Mitochondrial transport	NAS	10922475
GO:0016020	Component	Membrane	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	33253225
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	10922475
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0034514	Process	Mitochondrial unfolded protein response	IMP	28315685
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	30765471
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	IMP	22085049, 28808058
GO:0048821	Process	Erythrocyte development	IMP	22085049
GO:0055085	Process	Transmembrane transport	IEA
GO:0070455	Process	Positive regulation of heme biosynthetic process	ISS
GO:0140359	Function	ABC-type transporter activity	IDA	34011630, 37041204
GO:0140359	Function	ABC-type transporter activity	IEA
GO:0170037	Process	Export from the mitochondrion	IDA	34011630
GO:1990542	Process	Mitochondrial transmembrane transport	IEA

MIM	HGNC	e!Ensembl
605454	41	ENSG00000135776

Q9NRK6

Protein name

ATP-binding cassette sub-family B member 10, mitochondrial (ABC-mitochondrial erythroid protein) (ABC-me protein) (ATP-binding cassette transporter 10) (ABC transporter 10 protein) (EC 7.6.2.-) (Mitochondrial ATP-binding cassette 2) (M-ABC2)

Protein function

ATP-dependent transporter located in the mitochondrial inner membrane that catalyzes the export of biliverdin from the mitochondrial matrix, and plays a crucial role in hemoglobin synthesis and antioxidative stress (PubMed:22085049, PubMed:28315

PDB

3ZDQ , 4AYT , 4AYW , 4AYX , 7Y48 , 7Y49

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00664	ABC_membrane	171 → 442	ABC transporter transmembrane region	Family
PF00005	ABC_tran	510 → 662	ABC transporter	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymp

Sequence

MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLW
GVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPG
GPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTM
SSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSG
QRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
SVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGN
VRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEG
VILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLL
LRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTA
EEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEA
TSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLS
KPNGIYRKLMNKQSFISA

Sequence length

738

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28744405, 31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31931771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31381507, 33760208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31106654, 31931771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31381507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	35218958	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	22294766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	22294766		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31106654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28572033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28572033		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458, 30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31381507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	32572924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32633377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30802639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35756421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31556152, 31931771, 32572881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31106654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28744405, 31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33336739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31556152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32016969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ABCB10 (ATP binding cassette subfamily B member 10)