CENPW (centromere protein W)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387103
Gene name Centromere protein W
Gene symbol CENPW
Synonyms (NCBI Gene)
C6orf173CENP-WCUG2
Chromosome 6
Chromosome location 6q22.32
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT885458 hsa-miR-498 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Download as csvDownload as pdf
Transcription factor Regulation Reference
SP1 Unknown 20180024
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
30 Show/Hide all (30)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000278 Process Mitotic cell cycle IBA
GO:0000278 Process Mitotic cell cycle IEA
GO:0000278 Process Mitotic cell cycle IMP 21695110
GO:0000775 Component Chromosome, centromeric region IDA 19533040
GO:0000775 Component Chromosome, centromeric region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611264 21488 ENSG00000203760
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5EE01
Protein name Centromere protein W (CENP-W) (Cancer-up-regulated gene 2 protein)
Protein function Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation (By similarity). The CENPA-NAC complex recruits the CENPA-CAD (nu
PDB 7QOO , 7R5S , 7XHN , 7XHO , 7YWX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15510 CENP-W 1 → 88 CENP-W protein Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in ovary, liver, lung and pancreas and to a lower extent in breast and gastrointestinal tract cancers; such as those of the colon, rectum and stomach. Overexpressed in high grade breast invasive tumors. Expressed in ma
Sequence 
MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT
NACASKCRVINKEHVLAAAKVILKKSRG
Sequence length 88
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Deposition of new CENPA-containing nucleosomes at the centromere
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (16)
Phenotype Name Clinical Significance Source Reference Evidence Score
ANDROGENETIC ALOPECIA — GWAS catalog 28196072, 29146897, 30573740
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 35764056, 36738649
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER — GWAS catalog 35764056
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA — GWAS catalog 38182794
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR — CTD 28284560
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (13)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 32635817 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 33973496 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 24452380, 28776259, 30968157, 31113615
★★★★★
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 33725402 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 25107436 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Diabetes mellitus, type 1 Pubtator 21270831, 31455420 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma CTD_human_DG 28284560
★★★★★
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 27974707, 30226605, 35000669 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 24452380, 28776259, 30968157
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 30226605, 30771899, 30968157, 31113615
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
KLHL42 3 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic retinopathy 3 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic retinopathy) Related via 3 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. AP3S2 3 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic retinopathy 3 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic retinopathy) Related via 3 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. ARPIN-AP3S2 3 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic retinopathy 3 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic retinopathy) Related via 3 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. TMEM154 3 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic retinopathy 3 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic retinopathy) Related via 3 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. CDC123 3 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic retinopathy 3 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic retinopathy) Related via 3 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog.
Prostate cancer Linked via 2 of 5 related genesAP3S2, ARPIN-AP3S2 Diabetic neuropathy Linked via 2 of 5 related genesARPIN-AP3S2, CDC123 Alzheimer disease Linked via 1 of 5 related genesKLHL42 Oligodendroglioma Linked via 1 of 5 related genesARPIN-AP3S2 Colonic neoplasms Linked via 1 of 5 related genesTMEM154