UBC (ubiquitin C)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7316
• Gene name: Ubiquitin C
• Gene symbol: UBC
• Synonyms (NCBI Gene): HMG20
• Chromosome: 12
• Chromosome location: 12q24.31
• Summary: This gene represents a ubiquitin gene, ubiquitin C. The encoded protein is a polyubiquitin precursor. Conjugation of ubiquitin monomers or polymers can lead to various effects within a cell, depending on the residues to which ubiquitin is conjugated. Ubiq

miRNA Show/Hide all (84)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030628	hsa-miR-24-3p	qRT-PCR	19748357
MIRT050710	hsa-miR-18a-5p	CLASH	23622248
MIRT046896	hsa-miR-221-3p	CLASH	23622248
MIRT042909	hsa-miR-324-3p	CLASH	23622248
MIRT042909	hsa-miR-324-3p	CLASH	23622248
MIRT039711	hsa-miR-615-3p	CLASH	23622248
MIRT039711	hsa-miR-615-3p	CLASH	23622248
MIRT039075	hsa-miR-769-3p	CLASH	23622248
MIRT038409	hsa-miR-296-3p	CLASH	23622248
MIRT037302	hsa-miR-877-5p	CLASH	23622248
MIRT439367	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439366	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439367	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726202	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726200	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726201	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726199	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439366	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439367	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726202	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439366	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726200	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726199	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726201	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT1466908	hsa-miR-106a	CLIP-seq
MIRT1466909	hsa-miR-106b	CLIP-seq
MIRT1466910	hsa-miR-130a	CLIP-seq
MIRT1466911	hsa-miR-130b	CLIP-seq
MIRT1466912	hsa-miR-17	CLIP-seq
MIRT1466913	hsa-miR-20a	CLIP-seq
MIRT1466914	hsa-miR-20b	CLIP-seq
MIRT1466915	hsa-miR-301a	CLIP-seq
MIRT1466916	hsa-miR-301b	CLIP-seq
MIRT1466917	hsa-miR-454	CLIP-seq
MIRT1466918	hsa-miR-488	CLIP-seq
MIRT1466919	hsa-miR-519a	CLIP-seq
MIRT1466920	hsa-miR-519d	CLIP-seq
MIRT1466921	hsa-miR-653	CLIP-seq
MIRT1466922	hsa-miR-93	CLIP-seq
MIRT1466908	hsa-miR-106a	CLIP-seq
MIRT1466909	hsa-miR-106b	CLIP-seq
MIRT1466910	hsa-miR-130a	CLIP-seq
MIRT1466911	hsa-miR-130b	CLIP-seq
MIRT1466912	hsa-miR-17	CLIP-seq
MIRT1466913	hsa-miR-20a	CLIP-seq
MIRT1466914	hsa-miR-20b	CLIP-seq
MIRT1466915	hsa-miR-301a	CLIP-seq
MIRT1466916	hsa-miR-301b	CLIP-seq
MIRT1466917	hsa-miR-454	CLIP-seq
MIRT1466918	hsa-miR-488	CLIP-seq
MIRT1466919	hsa-miR-519a	CLIP-seq
MIRT1466920	hsa-miR-519d	CLIP-seq
MIRT1466921	hsa-miR-653	CLIP-seq
MIRT1466922	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	19733223
SP3	Unknown	19733223

Gene ontology (GO) Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	8702753, 16256071, 16424905, 16482222, 16763556, 16810318, 16845370, 16874300, 16874301, 16936636, 16996503, 17006543, 17028573, 17067581, 17070805, 17110928, 17139261, 17159902, 17170702, 17183367, 17255943, 17268548, 17290220, 17304240, 17318174, 17318178, 17320083, 17363902, 1736
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0019941	Process	Modification-dependent protein catabolic process	IBA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031386	Function	Protein tag activity	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 191340
• HGNC: 12468
• e!Ensembl: ENSG00000150991

Protein

• UniProt ID: P0CG48
• Protein name: Polyubiquitin-C [Cleaved into: Ubiquitin]
• Protein function: [Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys re
• PDB: 1C3T , 1CMX , 1D3Z , 1F9J , 1FXT , 1G6J , 1GJZ , 1NBF , 1OGW , 1Q5W , 1S1Q , 1SIF , 1TBE , 1UBI , 1UBQ , 1UD7 , 1XD3 , 1XQQ , 1YX5 , 1YX6 , 1ZGU , 2AYO , 2BGF , 2DEN , 2FUH , 2G45 , 2GBJ , 2GBK , 2GBM , 2GBN , 2GBR , 2GMI , 2HTH , 2IBI , 2J7Q , 2JF5 , 2JRI , 2JY6 , 2JZZ , 2K25 , 2K6D , 2K8B , 2K8C , 2KDF , 2KHW , 2KJH , 2KLG , 2KN5 , 2KX0 , 2L3Z , 2LD9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
  PF00240	ubiquitin	79 → 150	Ubiquitin family	Domain
  PF00240	ubiquitin	155 → 226	Ubiquitin family	Domain
  PF00240	ubiquitin	231 → 302	Ubiquitin family	Domain
  PF00240	ubiquitin	307 → 378	Ubiquitin family	Domain
  PF00240	ubiquitin	383 → 454	Ubiquitin family	Domain
  PF00240	ubiquitin	459 → 530	Ubiquitin family	Domain
  PF00240	ubiquitin	535 → 606	Ubiquitin family	Domain
  PF00240	ubiquitin	611 → 682	Ubiquitin family	Domain

• Sequence:

  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
  TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
  LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
  GRTLSDYNIQKESTLHLVLRLRGGV

• Sequence length: 685

Pathways

KEGG Pathway	Reactome Pathway
PPAR signaling pathway	Translesion synthesis by REV1
Ubiquitin mediated proteolysis	Recognition of DNA damage by PCNA-containing replication complex
Mitophagy - animal	Translesion Synthesis by POLH
Autophagy - animal	Activation of NF-kappaB in B cells
Parkinson disease	ISG15 antiviral mechanism
Pathways of neurodegeneration - multiple diseases	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Shigellosis	Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
Kaposi sarcoma-associated herpesvirus infection	Downregulation of ERBB4 signaling
	Spry regulation of FGF signaling
	Downregulation of ERBB2:ERBB3 signaling
	Budding and maturation of HIV virion
	NOD1/2 Signaling Pathway
	TICAM1, RIP1-mediated IKK complex recruitment
	DDX58/IFIH1-mediated induction of interferon-alpha/beta
	APC/C:Cdc20 mediated degradation of Cyclin B
	Autodegradation of Cdh1 by Cdh1:APC/C
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Membrane binding and targetting of GAG proteins
	Assembly Of The HIV Virion
	APC-Cdc20 mediated degradation of Nek2A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	EGFR downregulation
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	TCF dependent signaling in response to WNT
	Downstream TCR signaling
	NRIF signals cell death from the nucleus
	p75NTR recruits signalling complexes
	NF-kB is activated and signals survival
	Activated NOTCH1 Transmits Signal to the Nucleus
	Downregulation of TGF-beta receptor signaling
	TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition)
	Downregulation of SMAD2/3:SMAD4 transcriptional activity
	SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
	Separation of Sister Chromatids
	Oxidative Stress Induced Senescence
	Senescence-Associated Secretory Phenotype (SASP)
	Oncogene Induced Senescence
	Regulation of PLK1 Activity at G2/M Transition
	Constitutive Signaling by NOTCH1 PEST Domain Mutants
	Stimuli-sensing channels
	Constitutive Signaling by NOTCH1 HD Domain Mutants
	FCERI mediated NF-kB activation
	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
	Regulation of innate immune responses to cytosolic DNA
	Glycogen synthesis
	Autodegradation of the E3 ubiquitin ligase COP1
	Deactivation of the beta-catenin transactivating complex
	Myoclonic epilepsy of Lafora
	ABC-family proteins mediated transport
	TAK1 activates NFkB by phosphorylation and activation of IKKs complex
	activated TAK1 mediates p38 MAPK activation
	JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Regulation of FZD by ubiquitination
	Pink/Parkin Mediated Mitophagy
	N-glycan trimming in the ER and Calnexin/Calreticulin cycle
	Regulation of TNFR1 signaling
	TNFR1-induced NFkappaB signaling pathway
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Negative regulation of FGFR1 signaling
	Negative regulation of FGFR2 signaling
	Negative regulation of FGFR3 signaling
	Negative regulation of FGFR4 signaling
	Translesion synthesis by POLK
	Translesion synthesis by POLI
	Termination of translesion DNA synthesis
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	Negative regulation of MAPK pathway
	Regulation of necroptotic cell death
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAP3K8 (TPL2)-dependent MAPK1/3 activation
	HDR through Homologous Recombination (HRR)
	MAPK6/MAPK4 signaling
	UCH proteinases
	Josephin domain DUBs
	Ub-specific processing proteases
	Ovarian tumor domain proteases
	Metalloprotease DUBs
	Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
	Processing of DNA double-strand break ends
	DNA Damage Recognition in GG-NER
	Formation of Incision Complex in GG-NER
	Gap-filling DNA repair synthesis and ligation in GG-NER
	Dual Incision in GG-NER
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	Fanconi Anemia Pathway
	Regulation of TP53 Activity through Phosphorylation
	Regulation of TP53 Degradation
	Regulation of TP53 Activity through Methylation
	Negative regulation of MET activity
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	Cyclin D associated events in G1
	G2/M Checkpoints
	Stabilization of p53
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	Downregulation of ERBB2 signaling
	Synthesis of active ubiquitin: roles of E1 and E2 enzymes
	E3 ubiquitin ligases ubiquitinate target proteins
	InlB-mediated entry of Listeria monocytogenes into host cell
	InlA-mediated entry of Listeria monocytogenes into host cells
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN localization
	Regulation of PTEN stability and activity
	Neddylation
	ER Quality Control Compartment (ERQC)
	Regulation of expression of SLITs and ROBOs
	NOTCH3 Activation and Transmission of Signal to the Nucleus
	TICAM1-dependent activation of IRF3/IRF7
	TICAM1,TRAF6-dependent induction of TAK1 complex
	Interleukin-1 signaling
	Peroxisomal protein import
	Regulation of signaling by CBL
	Endosomal Sorting Complex Required For Transport (ESCRT)
	Iron uptake and transport
	Negative regulators of DDX58/IFIH1 signaling
	Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
	IRAK1 recruits IKK complex
	IKK complex recruitment mediated by RIP1
	IRAK2 mediated activation of TAK1 complex
	TRAF6-mediated induction of TAK1 complex within TLR4 complex
	Prevention of phagosomal-lysosomal fusion
	Modulation by Mtb of host immune system
	Alpha-protein kinase 1 signaling pathway
	Aggrephagy
	Pexophagy
	TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
	IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
	IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
	Amyloid fiber formation
	Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UBB 164 shared pathwaysFanconi anemia pathway, Ubiquitin mediated proteolysis, Mitophagy - animal, Autophagy - animal, Parkinson disease, Shigellosis, Kaposi sarcoma-associated herpesvirus infection, Downregulation of ERBB2:ERBB3 signaling, Regulation of TP53 Degradation, Regulation of PTEN stability and activity, Peroxisomal protein import, TICAM1-dependent activation of IRF3/IRF7 +152 more Related via 164 shared pathways including Fanconi anemia pathway, Ubiquitin mediated proteolysis. UBA52 164 shared pathwaysFanconi anemia pathway, Ubiquitin mediated proteolysis, Mitophagy - animal, Autophagy - animal, Parkinson disease, Shigellosis, Kaposi sarcoma-associated herpesvirus infection, Downregulation of ERBB2:ERBB3 signaling, Regulation of TP53 Degradation, Regulation of PTEN stability and activity, Peroxisomal protein import, TICAM1-dependent activation of IRF3/IRF7 +152 more Related via 164 shared pathways including Fanconi anemia pathway, Ubiquitin mediated proteolysis. RPS27A 164 shared pathwaysFanconi anemia pathway, Ubiquitin mediated proteolysis, Mitophagy - animal, Autophagy - animal, Parkinson disease, Shigellosis, Kaposi sarcoma-associated herpesvirus infection, Downregulation of ERBB2:ERBB3 signaling, Regulation of TP53 Degradation, Regulation of PTEN stability and activity, Peroxisomal protein import, TICAM1-dependent activation of IRF3/IRF7 +152 more Related via 164 shared pathways including Fanconi anemia pathway, Ubiquitin mediated proteolysis. PSMD14 50 shared pathwaysParkinson disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +38 more Related via 50 shared pathways including Parkinson disease, Regulation of PTEN stability and activity. PSMC1 50 shared pathwaysParkinson disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin, CDK-mediated phosphorylation and removal of Cdc6, Ubiquitin-dependent degradation of Cyclin D, Activation of NF-kappaB in B cells +38 more Related via 50 shared pathways including Parkinson disease, Regulation of PTEN stability and activity.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UBB	0	[]	164	["Fanconi anemia pathway","Ubiquitin mediated proteolysis","Mitophagy - animal","Autophagy - animal","Parkinson disease","Shigellosis","Kaposi sarcoma-associated herpesvirus infection","Downregulation of ERBB2:ERBB3 signaling","Regulation of TP53 Degradation","Regulation of PTEN stability and activity","Peroxisomal protein import","TICAM1-dependent activation of IRF3\/IRF7"]	0	[]
UBA52	0	[]	164	["Fanconi anemia pathway","Ubiquitin mediated proteolysis","Mitophagy - animal","Autophagy - animal","Parkinson disease","Shigellosis","Kaposi sarcoma-associated herpesvirus infection","Downregulation of ERBB2:ERBB3 signaling","Regulation of TP53 Degradation","Regulation of PTEN stability and activity","Peroxisomal protein import","TICAM1-dependent activation of IRF3\/IRF7"]	0	[]
RPS27A	0	[]	164	["Fanconi anemia pathway","Ubiquitin mediated proteolysis","Mitophagy - animal","Autophagy - animal","Parkinson disease","Shigellosis","Kaposi sarcoma-associated herpesvirus infection","Downregulation of ERBB2:ERBB3 signaling","Regulation of TP53 Degradation","Regulation of PTEN stability and activity","Peroxisomal protein import","TICAM1-dependent activation of IRF3\/IRF7"]	0	[]
PSMD14	0	[]	50	["Parkinson disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]
PSMC1	0	[]	50	["Parkinson disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin","CDK-mediated phosphorylation and removal of Cdc6","Ubiquitin-dependent degradation of Cyclin D","Activation of NF-kappaB in B cells"]	0	[]

Diseases Linked via Similar Genes

Amyotrophic lateral sclerosis Linked via 1 of 5 related genesUBB Cleft palate Linked via 1 of 5 related genesUBB Osteoarthritis Linked via 1 of 5 related genesUBA52 Central nervous system cancer Linked via 1 of 5 related genesPSMD14 Crohn disease Linked via 1 of 5 related genesPSMD14

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Amyotrophic lateral sclerosis	1	["UBB"]
Cleft palate	1	["UBB"]
Osteoarthritis	1	["UBA52"]
Central nervous system cancer	1	["PSMD14"]
Crohn disease	1	["PSMD14"]