Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10213
Gene name	Proteasome 26S subunit, non-ATPase 14
Gene symbol	PSMD14
Synonyms (NCBI Gene)	PAD1POH1RPN11
Chromosome	2
Chromosome location	2q24.2
Summary	This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S

89 Show/Hide all (89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046307	hsa-miR-23b-3p	CLASH	23622248
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270461	hsa-miR-186	CLIP-seq
MIRT1270462	hsa-miR-2276	CLIP-seq
MIRT1270463	hsa-miR-2355-3p	CLIP-seq
MIRT1270464	hsa-miR-25	CLIP-seq
MIRT1270465	hsa-miR-302f	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT1270467	hsa-miR-3133	CLIP-seq
MIRT1270468	hsa-miR-3171	CLIP-seq
MIRT1270469	hsa-miR-32	CLIP-seq
MIRT1270470	hsa-miR-363	CLIP-seq
MIRT1270471	hsa-miR-3667-5p	CLIP-seq
MIRT1270472	hsa-miR-367	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270476	hsa-miR-4282	CLIP-seq
MIRT1270477	hsa-miR-4436b-5p	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270479	hsa-miR-4646-3p	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270482	hsa-miR-4725-5p	CLIP-seq
MIRT1270483	hsa-miR-4732-3p	CLIP-seq
MIRT1270484	hsa-miR-4744	CLIP-seq
MIRT1270485	hsa-miR-4772-3p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270489	hsa-miR-495	CLIP-seq
MIRT1270490	hsa-miR-504	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270492	hsa-miR-518a-5p	CLIP-seq
MIRT1270493	hsa-miR-527	CLIP-seq
MIRT1270494	hsa-miR-568	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT1270498	hsa-miR-630	CLIP-seq
MIRT1270499	hsa-miR-664	CLIP-seq
MIRT1270500	hsa-miR-92a	CLIP-seq
MIRT1270501	hsa-miR-92b	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq

43 Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	9374539, 19214193
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	22909820
GO:0005515	Function	Protein binding	IPI	19615732, 25416956, 25959826, 26496610, 28514442, 32296183, 32814053, 33961781, 35100873
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IMP	22909820
GO:0006508	Process	Proteolysis	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	9374539
GO:0006974	Process	DNA damage response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	19214193
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IMP	22909820
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031597	Component	Cytosolic proteasome complex	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061133	Function	Endopeptidase activator activity	IMP	18162577
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IMP	18162577
GO:0061578	Function	K63-linked deubiquitinase activity	TAS
GO:0070536	Process	Protein K63-linked deubiquitination	IMP	22909820
GO:0070536	Process	Protein K63-linked deubiquitination	TAS	19214193
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IDA	18162577
GO:0140492	Function	Metal-dependent deubiquitinase activity	IBA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IEA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IMP	22909820
GO:0140492	Function	Metal-dependent deubiquitinase activity	TAS	19214193
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
607173	16889	ENSG00000115233

O00487

Protein name

26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01398	JAB	26 → 139	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
PF13012	MitMem_reg	173 → 307	Maintenance of mitochondrial structure and function	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highest levels in heart and skeletal muscle. {ECO:0000269|PubMed:9374539}.

Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK

Sequence length

310

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Epstein-Barr virus infection	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	Metalloprotease DUBs
	Neutrophil degranulation
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	30801121	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	30871063	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (34)
Alzheimer Disease	Alzheimer disease	Pubtator	27050411	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29848990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28141715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30038387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28535005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34839279	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38017133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28653889, 31685442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34745496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29573636, 31685442		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PSMC2	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC3	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC4	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC5	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC6	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]

PSMD14 (proteasome 26S subunit, non-ATPase 14)

Bookmark This Gene