PSMD14 (proteasome 26S subunit, non-ATPase 14)

Gene

• Entrez ID: 10213
• Gene name: Proteasome 26S subunit, non-ATPase 14
• Gene symbol: PSMD14
• Synonyms (NCBI Gene): PAD1, POH1, RPN11
• Chromosome: 2
• Chromosome location: 2q24.2
• Summary: This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT046307	hsa-miR-23b-3p	CLASH	23622248
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270461	hsa-miR-186	CLIP-seq
MIRT1270462	hsa-miR-2276	CLIP-seq
MIRT1270463	hsa-miR-2355-3p	CLIP-seq
MIRT1270464	hsa-miR-25	CLIP-seq
MIRT1270465	hsa-miR-302f	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT1270467	hsa-miR-3133	CLIP-seq
MIRT1270468	hsa-miR-3171	CLIP-seq
MIRT1270469	hsa-miR-32	CLIP-seq
MIRT1270470	hsa-miR-363	CLIP-seq
MIRT1270471	hsa-miR-3667-5p	CLIP-seq
MIRT1270472	hsa-miR-367	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270476	hsa-miR-4282	CLIP-seq
MIRT1270477	hsa-miR-4436b-5p	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270479	hsa-miR-4646-3p	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270482	hsa-miR-4725-5p	CLIP-seq
MIRT1270483	hsa-miR-4732-3p	CLIP-seq
MIRT1270484	hsa-miR-4744	CLIP-seq
MIRT1270485	hsa-miR-4772-3p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270489	hsa-miR-495	CLIP-seq
MIRT1270490	hsa-miR-504	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270492	hsa-miR-518a-5p	CLIP-seq
MIRT1270493	hsa-miR-527	CLIP-seq
MIRT1270494	hsa-miR-568	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT1270498	hsa-miR-630	CLIP-seq
MIRT1270499	hsa-miR-664	CLIP-seq
MIRT1270500	hsa-miR-92a	CLIP-seq
MIRT1270501	hsa-miR-92b	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq
MIRT1270460	hsa-miR-1322	CLIP-seq
MIRT1270466	hsa-miR-3125	CLIP-seq
MIRT2603089	hsa-miR-3672	CLIP-seq
MIRT2603090	hsa-miR-3910	CLIP-seq
MIRT1270473	hsa-miR-3914	CLIP-seq
MIRT1270474	hsa-miR-3916	CLIP-seq
MIRT1270475	hsa-miR-4257	CLIP-seq
MIRT1270478	hsa-miR-4480	CLIP-seq
MIRT2603091	hsa-miR-4493	CLIP-seq
MIRT2603092	hsa-miR-4499	CLIP-seq
MIRT1270480	hsa-miR-4662a-5p	CLIP-seq
MIRT1270481	hsa-miR-4694-5p	CLIP-seq
MIRT1270486	hsa-miR-4780	CLIP-seq
MIRT1270487	hsa-miR-4789-5p	CLIP-seq
MIRT1270488	hsa-miR-493	CLIP-seq
MIRT1270491	hsa-miR-512-3p	CLIP-seq
MIRT1270495	hsa-miR-582-5p	CLIP-seq
MIRT1270496	hsa-miR-600	CLIP-seq
MIRT1270497	hsa-miR-623	CLIP-seq
MIRT2603093	hsa-miR-633	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	9374539, 19214193
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	22909820
GO:0005515	Function	Protein binding	IPI	19615732, 25416956, 25959826, 26496610, 28514442, 32296183, 32814053, 33961781, 35100873
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006303	Process	Double-strand break repair via nonhomologous end joining	IMP	22909820
GO:0006508	Process	Proteolysis	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS	9374539
GO:0006974	Process	DNA damage response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	TAS	19214193
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IBA
GO:0008541	Component	Proteasome regulatory particle, lid subcomplex	IMP	22909820
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031597	Component	Cytosolic proteasome complex	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061133	Function	Endopeptidase activator activity	IMP	18162577
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IMP	18162577
GO:0061578	Function	K63-linked deubiquitinase activity	TAS
GO:0070536	Process	Protein K63-linked deubiquitination	IMP	22909820
GO:0070536	Process	Protein K63-linked deubiquitination	TAS	19214193
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IDA	18162577
GO:0140492	Function	Metal-dependent deubiquitinase activity	IBA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IEA
GO:0140492	Function	Metal-dependent deubiquitinase activity	IMP	22909820
GO:0140492	Function	Metal-dependent deubiquitinase activity	TAS	19214193
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 607173
• HGNC: 16889
• e!Ensembl: ENSG00000115233

Protein

• UniProt ID: O00487
• Protein name: 26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 5GJQ, 5GJR, 5L4K, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 5VGZ, 5VHF, 5VHH, 5VHI, 5VHS, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6WJD, 6WJN, 7QXN, 7QXP, 7QXU, 7QXW, 7QXX, 7QY7, 7QYA, 7QYB, 7W37, 7W38, 7W39, 7W3A, 7W3B, 7W3C, 7W3F, 7W3G, 7W3H, 7W3I, 7W3J, 7W3K, 7W3M
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01398	JAB	26 → 139	JAB1/Mov34/MPN/PAD-1 ubiquitin protease	Family
  PF13012	MitMem_reg	173 → 307	Maintenance of mitochondrial structure and function	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highest levels in heart and skeletal muscle. {ECO:0000269|PubMed:9374539}.
• Sequence:

  MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
  FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
  WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
  LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
  NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
  AAMLDTVVFK

• Sequence length: 310

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	27050411	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29848990	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28141715		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30038387		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28535005		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34839279	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38017133	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28653889, 31685442	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34745496	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29573636, 31685442		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31685442	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29331416, 29573636		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29331416, 29573636		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26510456, 29573636, 30745168, 31634528		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28535005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29331416, 29573636		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26510456		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31212367		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12553011, 28535005, 29573636, 30356695, 31212367, 31685442		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33154524	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28581522		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37935198	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12553011, 26510456, 28535005, 28844713, 29573636, 30745168, 31685442		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34383385	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34382324, 36328147	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37349676	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28457318		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28457318		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31212367		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29331416		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35750900	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28844713		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36632137	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37975230	Associate	★☆☆☆☆ Found in Text Mining only