Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7314
Gene name	Ubiquitin B
Gene symbol	UBB
Synonyms (NCBI Gene)	HEL-S-50
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene e

376

Show/Hide all (376)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029681	hsa-miR-26b-5p	Microarray	19088304
MIRT048633	hsa-miR-99a-5p	CLASH	23622248
MIRT048512	hsa-miR-100-5p	CLASH	23622248
MIRT047262	hsa-miR-181b-5p	CLASH	23622248
MIRT040746	hsa-miR-18a-3p	CLASH	23622248
MIRT039790	hsa-miR-615-3p	CLASH	23622248
MIRT038925	hsa-miR-92a-1-5p	CLASH	23622248
MIRT038186	hsa-miR-148b-5p	CLASH	23622248
MIRT036732	hsa-miR-760	CLASH	23622248
MIRT035905	hsa-miR-1287-5p	CLASH	23622248
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	20371350
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	20371350
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	20371350
MIRT520386	hsa-miR-612	PAR-CLIP	20371350
MIRT520385	hsa-miR-6860	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT520381	hsa-miR-2054	PAR-CLIP	20371350
MIRT520380	hsa-miR-4263	PAR-CLIP	20371350
MIRT520379	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT464873	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT464872	hsa-miR-4295	PAR-CLIP	21572407
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT464869	hsa-miR-3666	PAR-CLIP	21572407
MIRT464868	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT464867	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT464866	hsa-miR-4259	PAR-CLIP	21572407
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT464864	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	21572407
MIRT464860	hsa-miR-4260	PAR-CLIP	21572407
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23446348
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT520391	hsa-miR-5690	PAR-CLIP	23446348
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	23446348
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT520386	hsa-miR-612	PAR-CLIP	23446348
MIRT520385	hsa-miR-6860	PAR-CLIP	23446348
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT520383	hsa-miR-653-3p	PAR-CLIP	23446348
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT520381	hsa-miR-2054	PAR-CLIP	23446348
MIRT520380	hsa-miR-4263	PAR-CLIP	23446348
MIRT520379	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464872	hsa-miR-4295	PAR-CLIP	23592263
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464869	hsa-miR-3666	PAR-CLIP	23592263
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT464866	hsa-miR-4259	PAR-CLIP	23592263
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23592263
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT464860	hsa-miR-4260	PAR-CLIP	23592263
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	20371350
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	20371350
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	20371350
MIRT520386	hsa-miR-612	PAR-CLIP	20371350
MIRT520385	hsa-miR-6860	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT520381	hsa-miR-2054	PAR-CLIP	20371350
MIRT520380	hsa-miR-4263	PAR-CLIP	20371350
MIRT520379	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT464873	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT464872	hsa-miR-4295	PAR-CLIP	21572407
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT464869	hsa-miR-3666	PAR-CLIP	21572407
MIRT464868	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT464867	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT464866	hsa-miR-4259	PAR-CLIP	21572407
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT464864	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	21572407
MIRT464860	hsa-miR-4260	PAR-CLIP	21572407
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23446348
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT520391	hsa-miR-5690	PAR-CLIP	23446348
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	23446348
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT520386	hsa-miR-612	PAR-CLIP	23446348
MIRT520385	hsa-miR-6860	PAR-CLIP	23446348
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT520383	hsa-miR-653-3p	PAR-CLIP	23446348
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT520381	hsa-miR-2054	PAR-CLIP	23446348
MIRT520380	hsa-miR-4263	PAR-CLIP	23446348
MIRT520379	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464872	hsa-miR-4295	PAR-CLIP	23592263
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464869	hsa-miR-3666	PAR-CLIP	23592263
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT464866	hsa-miR-4259	PAR-CLIP	23592263
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23592263
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT464860	hsa-miR-4260	PAR-CLIP	23592263
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466901	hsa-miR-3143	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466904	hsa-miR-4477a	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466906	hsa-miR-543	CLIP-seq
MIRT1466907	hsa-miR-891a	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT2654788	hsa-miR-3136-5p	CLIP-seq
MIRT2654789	hsa-miR-3185	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT2654790	hsa-miR-4439	CLIP-seq
MIRT2654791	hsa-miR-4513	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT2654792	hsa-miR-4659a-5p	CLIP-seq
MIRT2654793	hsa-miR-4659b-5p	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT2654788	hsa-miR-3136-5p	CLIP-seq
MIRT2654789	hsa-miR-3185	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT2654790	hsa-miR-4439	CLIP-seq
MIRT2654791	hsa-miR-4513	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT2654792	hsa-miR-4659a-5p	CLIP-seq
MIRT2654793	hsa-miR-4659b-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HSF1	Unknown	20692357

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14755250, 14764729, 15039775, 15143060, 15308666, 16189514, 16286470, 16499958, 17310990, 17662948, 17719543, 18029035, 18313049, 20924359, 21516116, 24981860, 28514442, 32296183, 32814053, 33961781
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	17571083
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007141	Process	Male meiosis I	IEA
GO:0007144	Process	Female meiosis I	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008585	Process	Female gonad development	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0019941	Process	Modification-dependent protein catabolic process	IBA
GO:0021888	Process	Hypothalamus gonadotrophin-releasing hormone neuron development	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031386	Function	Protein tag activity	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	24660806
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0043005	Component	Neuron projection	IDA	17571083
GO:0043025	Component	Neuronal cell body	IDA	17571083
GO:0043523	Process	Regulation of neuron apoptotic process	IDA	17571083
GO:0047497	Process	Mitochondrion transport along microtubule	IDA	17571083
GO:0048812	Process	Neuron projection morphogenesis	IMP	17571083
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	17571083
GO:0060612	Process	Adipose tissue development	IEA
GO:0060613	Process	Fat pad development	IEA
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	17571083
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072520	Process	Seminiferous tubule development	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:1902255	Process	Positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator	IDA	17571083
GO:1902527	Process	Positive regulation of protein monoubiquitination	IMP	24660806

MIM	HGNC	e!Ensembl
191339	12463	ENSG00000170315

P0CG47

Protein name

Polyubiquitin-B [Cleaved into: Ubiquitin]

Protein function

[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys re

PDB

2KHW , 2MBB , 2MRO , 2MSG , 2N13 , 4UEL , 4UF6 , 4WHV , 4WLR , 4WUR , 4XOF , 4ZFR , 4ZFT , 4ZPZ , 4ZUX , 5BNB , 5CAW , 5CRA , 5CVM , 5CVN , 5CVO , 5D0K , 5D0M , 5DFL , 5DK8 , 5E6J , 5EDV , 5EMZ , 5EYA , 5GJQ , 5GO7 , 5GO8 , 5GOB , 5GOC , 5GOD , 5GOG , 5GOH , 5GOI , 5GOJ , 5GOK , 5H7S , 5IBK , 5IFR , 5JBY , 5JG6 , 5JP3 , 5JTJ , 5JTV , 5K9P , 5KGF , 5KHY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
PF00240	ubiquitin	79 → 150	Ubiquitin family	Domain
PF00240	ubiquitin	155 → 226	Ubiquitin family	Domain

Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC

Sequence length

229

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE, ISOLATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	12007022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11980917, 23844119, 32812532, 37739965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29130934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	29130934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24367661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24367661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Soft Palate	Cleft Soft Palate	ORPHANET_DG	17468296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Soft Palate	Cleft Soft Palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft uvula	Cleft Uvula	ORPHANET_DG	17468296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32812532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	12893422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	10911966, 11124436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	10666673, 12055595, 16432153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	11139590	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29130934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29130934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33176591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	30738879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35645616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	12893422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15198995, 16226348, 17052186, 18760506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	15452314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	17052186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31618209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	14597671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	15198995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29130934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31081222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24367661, 29130934, 31096896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24367661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37515398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	17405812		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOFIBRILLAR, 3	Myofibrillar myopathy	BEFREE	17931355		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOFIBRILLAR, DESMIN-RELATED	Myofibrillar myopathy	BEFREE	17931355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	LHGDN	15452314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22057347, 24367661, 29130934, 29130938		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	12007022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11726544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10674623, 14597671, 16714280, 21762696, 27966098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25820571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Dysphagia	Oropharyngeal Dysphagia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29344651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29130934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29130934	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31257224, 32192517, 35281472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	16213790, 17052186, 21731658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21731658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	14597671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	12893422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	10674623, 12871580, 15050720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Receptive language delay	Receptive language delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	11124436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31081222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32751694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Submucous cleft of hard palate	Submucosal cleft palate	ORPHANET_DG	17468296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Submucous cleft palate	Submucosal cleft palate	ORPHANET_DG	17468296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Submucous cleft soft palate	Submucous cleft of soft and hard palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	14597671, 15198995, 17052186, 17405812, 18760506, 21059367, 21762696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	29130934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Velopharyngeal Insufficiency	Velopharyngeal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

UBB (ubiquitin B)