Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7314
Gene name	Ubiquitin B
Gene symbol	UBB
Synonyms (NCBI Gene)	HEL-S-50
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene e

376 Show/Hide all (376)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029681	hsa-miR-26b-5p	Microarray	19088304
MIRT048633	hsa-miR-99a-5p	CLASH	23622248
MIRT048512	hsa-miR-100-5p	CLASH	23622248
MIRT047262	hsa-miR-181b-5p	CLASH	23622248
MIRT040746	hsa-miR-18a-3p	CLASH	23622248
MIRT039790	hsa-miR-615-3p	CLASH	23622248
MIRT038925	hsa-miR-92a-1-5p	CLASH	23622248
MIRT038186	hsa-miR-148b-5p	CLASH	23622248
MIRT036732	hsa-miR-760	CLASH	23622248
MIRT035905	hsa-miR-1287-5p	CLASH	23622248
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	20371350
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	20371350
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	20371350
MIRT520386	hsa-miR-612	PAR-CLIP	20371350
MIRT520385	hsa-miR-6860	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT520381	hsa-miR-2054	PAR-CLIP	20371350
MIRT520380	hsa-miR-4263	PAR-CLIP	20371350
MIRT520379	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT464873	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT464872	hsa-miR-4295	PAR-CLIP	21572407
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT464869	hsa-miR-3666	PAR-CLIP	21572407
MIRT464868	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT464867	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT464866	hsa-miR-4259	PAR-CLIP	21572407
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT464864	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	21572407
MIRT464860	hsa-miR-4260	PAR-CLIP	21572407
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23446348
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT520391	hsa-miR-5690	PAR-CLIP	23446348
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	23446348
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT520386	hsa-miR-612	PAR-CLIP	23446348
MIRT520385	hsa-miR-6860	PAR-CLIP	23446348
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT520383	hsa-miR-653-3p	PAR-CLIP	23446348
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT520381	hsa-miR-2054	PAR-CLIP	23446348
MIRT520380	hsa-miR-4263	PAR-CLIP	23446348
MIRT520379	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464872	hsa-miR-4295	PAR-CLIP	23592263
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464869	hsa-miR-3666	PAR-CLIP	23592263
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT464866	hsa-miR-4259	PAR-CLIP	23592263
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23592263
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT464860	hsa-miR-4260	PAR-CLIP	23592263
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	20371350
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	20371350
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	20371350
MIRT520386	hsa-miR-612	PAR-CLIP	20371350
MIRT520385	hsa-miR-6860	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	20371350
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	20371350
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT464873	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT464872	hsa-miR-4295	PAR-CLIP	20371350
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT464869	hsa-miR-3666	PAR-CLIP	20371350
MIRT464868	hsa-miR-495-5p	PAR-CLIP	20371350
MIRT464867	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT464866	hsa-miR-4259	PAR-CLIP	20371350
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT464864	hsa-miR-486-3p	PAR-CLIP	20371350
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	20371350
MIRT520383	hsa-miR-653-3p	PAR-CLIP	20371350
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	20371350
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT520381	hsa-miR-2054	PAR-CLIP	20371350
MIRT520380	hsa-miR-4263	PAR-CLIP	20371350
MIRT520379	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT464860	hsa-miR-4260	PAR-CLIP	20371350
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	21572407
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	21572407
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT464873	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT464872	hsa-miR-4295	PAR-CLIP	21572407
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT464869	hsa-miR-3666	PAR-CLIP	21572407
MIRT464868	hsa-miR-495-5p	PAR-CLIP	21572407
MIRT464867	hsa-miR-382-5p	PAR-CLIP	21572407
MIRT464866	hsa-miR-4259	PAR-CLIP	21572407
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT464864	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	21572407
MIRT464860	hsa-miR-4260	PAR-CLIP	21572407
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23446348
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT520392	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT520391	hsa-miR-5690	PAR-CLIP	23446348
MIRT520390	hsa-miR-6884-3p	PAR-CLIP	23446348
MIRT520389	hsa-miR-1285-3p	PAR-CLIP	23446348
MIRT520388	hsa-miR-3187-5p	PAR-CLIP	23446348
MIRT520387	hsa-miR-5189-5p	PAR-CLIP	23446348
MIRT520386	hsa-miR-612	PAR-CLIP	23446348
MIRT520385	hsa-miR-6860	PAR-CLIP	23446348
MIRT520384	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT520383	hsa-miR-653-3p	PAR-CLIP	23446348
MIRT520382	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT520381	hsa-miR-2054	PAR-CLIP	23446348
MIRT520380	hsa-miR-4263	PAR-CLIP	23446348
MIRT520379	hsa-miR-576-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT464872	hsa-miR-4295	PAR-CLIP	23446348
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT464869	hsa-miR-3666	PAR-CLIP	23446348
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23446348
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT464866	hsa-miR-4259	PAR-CLIP	23446348
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23446348
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23446348
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23446348
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23446348
MIRT464860	hsa-miR-4260	PAR-CLIP	23446348
MIRT464877	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT464876	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT464875	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT464874	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT464873	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT464872	hsa-miR-4295	PAR-CLIP	23592263
MIRT464871	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT464870	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT464869	hsa-miR-3666	PAR-CLIP	23592263
MIRT464868	hsa-miR-495-5p	PAR-CLIP	23592263
MIRT464867	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT464866	hsa-miR-4259	PAR-CLIP	23592263
MIRT464865	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT464864	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT464863	hsa-miR-4671-3p	PAR-CLIP	23592263
MIRT464862	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT464861	hsa-miR-1227-5p	PAR-CLIP	23592263
MIRT464860	hsa-miR-4260	PAR-CLIP	23592263
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466901	hsa-miR-3143	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466904	hsa-miR-4477a	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466906	hsa-miR-543	CLIP-seq
MIRT1466907	hsa-miR-891a	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT2654788	hsa-miR-3136-5p	CLIP-seq
MIRT2654789	hsa-miR-3185	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT2654790	hsa-miR-4439	CLIP-seq
MIRT2654791	hsa-miR-4513	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT2654792	hsa-miR-4659a-5p	CLIP-seq
MIRT2654793	hsa-miR-4659b-5p	CLIP-seq
MIRT1466896	hsa-miR-1285	CLIP-seq
MIRT1466897	hsa-miR-130a	CLIP-seq
MIRT1466898	hsa-miR-130b	CLIP-seq
MIRT1466899	hsa-miR-301a	CLIP-seq
MIRT1466900	hsa-miR-301b	CLIP-seq
MIRT2654788	hsa-miR-3136-5p	CLIP-seq
MIRT2654789	hsa-miR-3185	CLIP-seq
MIRT1466902	hsa-miR-365	CLIP-seq
MIRT1466903	hsa-miR-382	CLIP-seq
MIRT2654790	hsa-miR-4439	CLIP-seq
MIRT2654791	hsa-miR-4513	CLIP-seq
MIRT1466905	hsa-miR-454	CLIP-seq
MIRT2654792	hsa-miR-4659a-5p	CLIP-seq
MIRT2654793	hsa-miR-4659b-5p	CLIP-seq

Transcription factor	Regulation	Reference
HSF1	Unknown	20692357

43 Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14755250, 14764729, 15039775, 15143060, 15308666, 16189514, 16286470, 16499958, 17310990, 17662948, 17719543, 18029035, 18313049, 20924359, 21516116, 24981860, 28514442, 32296183, 32814053, 33961781
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	17571083
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007141	Process	Male meiosis I	IEA
GO:0007144	Process	Female meiosis I	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008585	Process	Female gonad development	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0019941	Process	Modification-dependent protein catabolic process	IBA
GO:0021888	Process	Hypothalamus gonadotrophin-releasing hormone neuron development	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031386	Function	Protein tag activity	IBA
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	24660806
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031982	Component	Vesicle	HDA	19190083
GO:0043005	Component	Neuron projection	IDA	17571083
GO:0043025	Component	Neuronal cell body	IDA	17571083
GO:0043523	Process	Regulation of neuron apoptotic process	IDA	17571083
GO:0047497	Process	Mitochondrion transport along microtubule	IDA	17571083
GO:0048812	Process	Neuron projection morphogenesis	IMP	17571083
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	17571083
GO:0060612	Process	Adipose tissue development	IEA
GO:0060613	Process	Fat pad development	IEA
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	17571083
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072520	Process	Seminiferous tubule development	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:1902255	Process	Positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator	IDA	17571083
GO:1902527	Process	Positive regulation of protein monoubiquitination	IMP	24660806

MIM	HGNC	e!Ensembl
191339	12463	ENSG00000170315

P0CG47

Protein name

Polyubiquitin-B [Cleaved into: Ubiquitin]

Protein function

[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys re

PDB

2KHW , 2MBB , 2MRO , 2MSG , 2N13 , 4UEL , 4UF6 , 4WHV , 4WLR , 4WUR , 4XOF , 4ZFR , 4ZFT , 4ZPZ , 4ZUX , 5BNB , 5CAW , 5CRA , 5CVM , 5CVN , 5CVO , 5D0K , 5D0M , 5DFL , 5DK8 , 5E6J , 5EDV , 5EMZ , 5EYA , 5GJQ , 5GO7 , 5GO8 , 5GOB , 5GOC , 5GOD , 5GOG , 5GOH , 5GOI , 5GOJ , 5GOK , 5H7S , 5IBK , 5IFR , 5JBY , 5JG6 , 5JP3 , 5JTJ , 5JTV , 5K9P , 5KGF , 5KHY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 74	Ubiquitin family	Domain
PF00240	ubiquitin	79 → 150	Ubiquitin family	Domain
PF00240	ubiquitin	155 → 226	Ubiquitin family	Domain

Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC

Sequence length

229

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Ubiquitin mediated proteolysis	Translesion synthesis by REV1
Mitophagy - animal	Recognition of DNA damage by PCNA-containing replication complex
Autophagy - animal	Translesion Synthesis by POLH
Parkinson disease	Activation of NF-kappaB in B cells
Pathways of neurodegeneration - multiple diseases	ISG15 antiviral mechanism
Shigellosis	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Kaposi sarcoma-associated herpesvirus infection	Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
	Downregulation of ERBB4 signaling
	Spry regulation of FGF signaling
	Downregulation of ERBB2:ERBB3 signaling
	Budding and maturation of HIV virion
	NOD1/2 Signaling Pathway
	TICAM1, RIP1-mediated IKK complex recruitment
	DDX58/IFIH1-mediated induction of interferon-alpha/beta
	APC/C:Cdc20 mediated degradation of Cyclin B
	Autodegradation of Cdh1 by Cdh1:APC/C
	SCF-beta-TrCP mediated degradation of Emi1
	APC/C:Cdc20 mediated degradation of Securin
	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Membrane binding and targetting of GAG proteins
	Assembly Of The HIV Virion
	APC-Cdc20 mediated degradation of Nek2A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	EGFR downregulation
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	TCF dependent signaling in response to WNT
	Downstream TCR signaling
	NRIF signals cell death from the nucleus
	p75NTR recruits signalling complexes
	NF-kB is activated and signals survival
	Activated NOTCH1 Transmits Signal to the Nucleus
	Downregulation of TGF-beta receptor signaling
	TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition)
	Downregulation of SMAD2/3:SMAD4 transcriptional activity
	SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
	Separation of Sister Chromatids
	Oxidative Stress Induced Senescence
	Senescence-Associated Secretory Phenotype (SASP)
	Oncogene Induced Senescence
	Regulation of PLK1 Activity at G2/M Transition
	Constitutive Signaling by NOTCH1 PEST Domain Mutants
	Stimuli-sensing channels
	Constitutive Signaling by NOTCH1 HD Domain Mutants
	FCERI mediated NF-kB activation
	Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
	Regulation of innate immune responses to cytosolic DNA
	Glycogen synthesis
	Autodegradation of the E3 ubiquitin ligase COP1
	Deactivation of the beta-catenin transactivating complex
	Myoclonic epilepsy of Lafora
	ABC-family proteins mediated transport
	TAK1 activates NFkB by phosphorylation and activation of IKKs complex
	activated TAK1 mediates p38 MAPK activation
	JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Regulation of FZD by ubiquitination
	Pink/Parkin Mediated Mitophagy
	N-glycan trimming in the ER and Calnexin/Calreticulin cycle
	Regulation of TNFR1 signaling
	TNFR1-induced NFkappaB signaling pathway
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Negative regulation of FGFR1 signaling
	Negative regulation of FGFR2 signaling
	Negative regulation of FGFR3 signaling
	Negative regulation of FGFR4 signaling
	Translesion synthesis by POLK
	Translesion synthesis by POLI
	Termination of translesion DNA synthesis
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	Negative regulation of MAPK pathway
	Regulation of necroptotic cell death
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAP3K8 (TPL2)-dependent MAPK1/3 activation
	HDR through Homologous Recombination (HRR)
	MAPK6/MAPK4 signaling
	UCH proteinases
	Josephin domain DUBs
	Ub-specific processing proteases
	Ovarian tumor domain proteases
	Metalloprotease DUBs
	Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
	Processing of DNA double-strand break ends
	DNA Damage Recognition in GG-NER
	Formation of Incision Complex in GG-NER
	Gap-filling DNA repair synthesis and ligation in GG-NER
	Dual Incision in GG-NER
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	Fanconi Anemia Pathway
	Regulation of TP53 Activity through Phosphorylation
	Regulation of TP53 Degradation
	Regulation of TP53 Activity through Methylation
	Negative regulation of MET activity
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	Cyclin D associated events in G1
	G2/M Checkpoints
	Stabilization of p53
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	Cargo recognition for clathrin-mediated endocytosis
	Clathrin-mediated endocytosis
	Downregulation of ERBB2 signaling
	Synthesis of active ubiquitin: roles of E1 and E2 enzymes
	E3 ubiquitin ligases ubiquitinate target proteins
	InlB-mediated entry of Listeria monocytogenes into host cell
	InlA-mediated entry of Listeria monocytogenes into host cells
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN localization
	Regulation of PTEN stability and activity
	Neddylation
	ER Quality Control Compartment (ERQC)
	Regulation of expression of SLITs and ROBOs
	NOTCH3 Activation and Transmission of Signal to the Nucleus
	TICAM1-dependent activation of IRF3/IRF7
	TICAM1,TRAF6-dependent induction of TAK1 complex
	Interleukin-1 signaling
	Peroxisomal protein import
	Regulation of signaling by CBL
	Endosomal Sorting Complex Required For Transport (ESCRT)
	Iron uptake and transport
	Negative regulators of DDX58/IFIH1 signaling
	Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
	IRAK1 recruits IKK complex
	IKK complex recruitment mediated by RIP1
	IRAK2 mediated activation of TAK1 complex
	TRAF6-mediated induction of TAK1 complex within TLR4 complex
	Prevention of phagosomal-lysosomal fusion
	Modulation by Mtb of host immune system
	Alpha-protein kinase 1 signaling pathway
	Aggrephagy
	Pexophagy
	TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
	IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
	IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
	Amyloid fiber formation
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	22994484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE, ISOLATED	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (65)
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	12007022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	11980917, 23844119, 32812532, 37739965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29130934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	29130934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24367661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24367661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Soft Palate	Cleft Soft Palate	ORPHANET_DG	17468296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Soft Palate	Cleft Soft Palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft uvula	Cleft Uvula	ORPHANET_DG	17468296		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UBC	[]	164	["Fanconi anemia pathway","Ubiquitin mediated proteolysis","Mitophagy - animal","Autophagy - animal","Parkinson disease","Shigellosis","Kaposi sarcoma-associated herpesvirus infection","Downregulation of ERBB2:ERBB3 signaling","Regulation of TP53 Degradation","Regulation of PTEN stability and activity","Peroxisomal protein import","TICAM1-dependent activation of IRF3\/IRF7"]	0	[]
UBA52	[]	164	["Fanconi anemia pathway","Ubiquitin mediated proteolysis","Mitophagy - animal","Autophagy - animal","Parkinson disease","Shigellosis","Kaposi sarcoma-associated herpesvirus infection","Downregulation of ERBB2:ERBB3 signaling","Regulation of TP53 Degradation","Regulation of PTEN stability and activity","Peroxisomal protein import","TICAM1-dependent activation of IRF3\/IRF7"]	0	[]
RPS27A	[]	164	["Fanconi anemia pathway","Ubiquitin mediated proteolysis","Mitophagy - animal","Autophagy - animal","Parkinson disease","Shigellosis","Kaposi sarcoma-associated herpesvirus infection","Downregulation of ERBB2:ERBB3 signaling","Regulation of TP53 Degradation","Regulation of PTEN stability and activity","Peroxisomal protein import","TICAM1-dependent activation of IRF3\/IRF7"]	0	[]
FGF6	[]	3	["Negative regulation of FGFR1 signaling","Negative regulation of FGFR2 signaling","Negative regulation of FGFR4 signaling"]	2	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)"]
SCFD1	[]	0	[]	2	["Disgenet (Amyotrophic lateral sclerosis)","CTD (Amyotrophic lateral sclerosis)"]

UBB (ubiquitin B)

Bookmark This Gene