CACNG6 (calcium voltage-gated channel auxiliary subunit gamma 6)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 59285
Gene name Calcium voltage-gated channel auxiliary subunit gamma 6
Gene symbol CACNG6
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.42
Summary Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is an integral membrane protein that
miRNA miRNA information provided by mirtarbase database.
21 Show/Hide all (21)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT650164 hsa-miR-3606-3p HITS-CLIP 23824327
MIRT650163 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT650162 hsa-miR-513c-3p HITS-CLIP 23824327
MIRT650161 hsa-miR-4733-5p HITS-CLIP 23824327
MIRT650160 hsa-miR-1288-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005245 Function Voltage-gated calcium channel activity NAS 11170751
GO:0005246 Function Calcium channel regulator activity IBA
GO:0005246 Function Calcium channel regulator activity IDA 21127204
GO:0005262 Function Calcium channel activity IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606898 13625 ENSG00000130433
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXT2
Protein name Voltage-dependent calcium channel gamma-6 subunit (Neuronal voltage-gated calcium channel gamma-6 subunit)
Protein function Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13903 Claudin_2 47 → 241 PMP-22/EMP/MP20/Claudin tight junction Family
Tissue specificity TISSUE SPECIFICITY: Detected in heart left ventricle. {ECO:0000269|PubMed:21127204}.
Sequence 
MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTE
FWVELNTYKANGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFF
TTGENARIFQRTTKKEVNLAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL
SGLLLLVSLEVFRHSVRALLQRVSPEPPPAPRLTYEYSWSLGCGVGAGLILLLGAGCFLL
LTLPSWPWGSLCPKRGHRAT
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
MAPK signaling pathway Phase 0 - rapid depolarisation
Cardiac muscle contraction Phase 2 - plateau phase
Adrenergic signaling in cardiomyocytes  
Oxytocin signaling pathway  
Hypertrophic cardiomyopathy  
Arrhythmogenic right ventricular cardiomyopathy  
Dilated cardiomyopathy  
Sort by:
CACNG7 9 shared pathwaysMAPK signaling pathway, Cardiac muscle contraction, Adrenergic signaling in cardiomyocytes, Oxytocin signaling pathway, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Phase 2 - plateau phase, Phase 0 - rapid depolarisation Related via 9 shared pathways including MAPK signaling pathway, Cardiac muscle contraction. CACNA2D4 9 shared pathwaysMAPK signaling pathway, Cardiac muscle contraction, Adrenergic signaling in cardiomyocytes, Oxytocin signaling pathway, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Phase 2 - plateau phase, Phase 0 - rapid depolarisation Related via 9 shared pathways including MAPK signaling pathway, Cardiac muscle contraction. CACNA2D3 9 shared pathwaysMAPK signaling pathway, Cardiac muscle contraction, Adrenergic signaling in cardiomyocytes, Oxytocin signaling pathway, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Phase 2 - plateau phase, Phase 0 - rapid depolarisation Related via 9 shared pathways including MAPK signaling pathway, Cardiac muscle contraction. CACNA2D1 9 shared pathwaysMAPK signaling pathway, Cardiac muscle contraction, Adrenergic signaling in cardiomyocytes, Oxytocin signaling pathway, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Phase 2 - plateau phase, Phase 0 - rapid depolarisation Related via 9 shared pathways including MAPK signaling pathway, Cardiac muscle contraction. CACNB1 9 shared pathwaysMAPK signaling pathway, Cardiac muscle contraction, Adrenergic signaling in cardiomyocytes, Oxytocin signaling pathway, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy, Dilated cardiomyopathy, Phase 2 - plateau phase, Phase 0 - rapid depolarisation Related via 9 shared pathways including MAPK signaling pathway, Cardiac muscle contraction.
Alzheimer disease Linked via 2 of 5 related genesCACNG7, CACNA2D3 Intellectual developmental disorder Linked via 2 of 5 related genesCACNG7, CACNA2D1 Bipolar disorder Linked via 2 of 5 related genesCACNA2D3, CACNA2D1 Major depressive disorder Linked via 2 of 5 related genesCACNA2D3, CACNA2D1 Neurodevelopmental disorder Linked via 2 of 5 related genesCACNA2D3, CACNA2D1