PPP2R3B (protein phosphatase 2 regulatory subunit B''beta)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 28227
• Gene name: Protein phosphatase 2 regulatory subunit B''beta
• Gene symbol: PPP2R3B
• Synonyms (NCBI Gene): NYREN8, PPP2R3L, PPP2R3LY, PR48, PR70
• Chromosome: X|Y
• Chromosome location: X;Y
• Summary: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subu

miRNA Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024826	hsa-miR-215-5p	Microarray	19074876
MIRT026231	hsa-miR-192-5p	Microarray	19074876
MIRT739549	hsa-miR-1285	CLIP-seq
MIRT1257761	hsa-miR-3150a-3p	CLIP-seq
MIRT1257762	hsa-miR-3175	CLIP-seq
MIRT739548	hsa-miR-3187-5p	CLIP-seq
MIRT739553	hsa-miR-326	CLIP-seq
MIRT739554	hsa-miR-330-5p	CLIP-seq
MIRT739551	hsa-miR-378g	CLIP-seq
MIRT1257763	hsa-miR-3960	CLIP-seq
MIRT1257764	hsa-miR-4467	CLIP-seq
MIRT739552	hsa-miR-4486	CLIP-seq
MIRT739547	hsa-miR-4736	CLIP-seq
MIRT1257765	hsa-miR-491-5p	CLIP-seq
MIRT739550	hsa-miR-612	CLIP-seq
MIRT1257766	hsa-miR-939	CLIP-seq
MIRT739549	hsa-miR-1285	CLIP-seq
MIRT739548	hsa-miR-3187-5p	CLIP-seq
MIRT739553	hsa-miR-326	CLIP-seq
MIRT739554	hsa-miR-330-5p	CLIP-seq
MIRT739551	hsa-miR-378g	CLIP-seq
MIRT739552	hsa-miR-4486	CLIP-seq
MIRT739547	hsa-miR-4736	CLIP-seq
MIRT739550	hsa-miR-612	CLIP-seq
MIRT739549	hsa-miR-1285	CLIP-seq
MIRT739548	hsa-miR-3187-5p	CLIP-seq
MIRT739553	hsa-miR-326	CLIP-seq
MIRT739554	hsa-miR-330-5p	CLIP-seq
MIRT739551	hsa-miR-378g	CLIP-seq
MIRT739552	hsa-miR-4486	CLIP-seq
MIRT739547	hsa-miR-4736	CLIP-seq
MIRT739550	hsa-miR-612	CLIP-seq
MIRT739549	hsa-miR-1285	CLIP-seq
MIRT739548	hsa-miR-3187-5p	CLIP-seq
MIRT739553	hsa-miR-326	CLIP-seq
MIRT739554	hsa-miR-330-5p	CLIP-seq
MIRT739551	hsa-miR-378g	CLIP-seq
MIRT739552	hsa-miR-4486	CLIP-seq
MIRT739547	hsa-miR-4736	CLIP-seq
MIRT739550	hsa-miR-612	CLIP-seq
MIRT739549	hsa-miR-1285	CLIP-seq
MIRT739548	hsa-miR-3187-5p	CLIP-seq
MIRT739553	hsa-miR-326	CLIP-seq
MIRT739554	hsa-miR-330-5p	CLIP-seq
MIRT739551	hsa-miR-378g	CLIP-seq
MIRT739552	hsa-miR-4486	CLIP-seq
MIRT739547	hsa-miR-4736	CLIP-seq
MIRT739550	hsa-miR-612	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	ISS
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	9847399, 21516116, 25416956, 27812135, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	10629059
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005929	Component	Cilium	IDA
GO:0006470	Process	Protein dephosphorylation	ISS
GO:0019888	Function	Protein phosphatase regulator activity	IBA
GO:0019888	Function	Protein phosphatase regulator activity	ISS
GO:0019888	Function	Protein phosphatase regulator activity	TAS	10629059
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	10629059

Other IDs

• MIM: 300339
• HGNC: 13417
• e!Ensembl: ENSG00000167393

Protein

• UniProt ID: Q9Y5P8
• Protein name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta (PP2A subunit B isoform PR48) (Protein phosphatase 2A 48 kDa regulatory subunit)
• Protein function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment.
• PDB: 4I5L , 4I5N , 4MEW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	316 → 418	EF-hand domain pair	Domain
  PF17958	EF-hand_13	212 → 301	EF-hand domain	Domain

• Sequence:

  MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPT
  APLAAPRPSGLEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPA
  TSQSIPTFYFPRGRPQDSVNVDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKG
  PLFYGAGGERTGSVSVHKFVAMWRKILQNCHDDAAKFVHLLMSPGCNYLVQEDFVPFLQD
  VVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGRITCAELRRSSFLQNVALLEE
  EADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTKMIDRIFSGAV
  TRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
  CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDH
  EQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSA
  LRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

• Sequence length: 575

Pathways

KEGG Pathway	Reactome Pathway
mRNA surveillance pathway	Inhibition of replication initiation of damaged DNA by RB1/E2F1
Sphingolipid signaling pathway	Cyclin D associated events in G1
PI3K-Akt signaling pathway	Cyclin A/B1/B2 associated events during G2/M transition
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
T cell receptor signaling pathway
Dopaminergic synapse
Human papillomavirus infection

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PPP2R3C 6 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse Related via 6 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R3A 6 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse Related via 6 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R2A 8 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse, Cyclin A/B1/B2 associated events during G2/M transition, Cyclin D associated events in G1 Related via 8 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R2B 6 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse Related via 6 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R2C 6 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse Related via 6 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PPP2R3C	0	[]	6	["mRNA surveillance pathway","Sphingolipid signaling pathway","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse"]	0	[]
PPP2R3A	0	[]	6	["mRNA surveillance pathway","Sphingolipid signaling pathway","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse"]	0	[]
PPP2R2A	0	[]	8	["mRNA surveillance pathway","Sphingolipid signaling pathway","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","Cyclin A\/B1\/B2 associated events during G2\/M transition","Cyclin D associated events in G1"]	0	[]
PPP2R2B	0	[]	6	["mRNA surveillance pathway","Sphingolipid signaling pathway","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse"]	0	[]
PPP2R2C	0	[]	6	["mRNA surveillance pathway","Sphingolipid signaling pathway","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesPPP2R3C, PPP2R3A, PPP2R2B Bipolar disorder Linked via 3 of 5 related genesPPP2R3A, PPP2R2B, PPP2R2C Diabetes mellitus type 2 Linked via 3 of 5 related genesPPP2R3A, PPP2R2B, PPP2R2C Coronary artery disease Linked via 2 of 5 related genesPPP2R3A, PPP2R2A Metabolic syndrome Linked via 2 of 5 related genesPPP2R3A, PPP2R2C

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["PPP2R3C","PPP2R3A","PPP2R2B"]
Bipolar disorder	3	["PPP2R3A","PPP2R2B","PPP2R2C"]
Diabetes mellitus type 2	3	["PPP2R3A","PPP2R2B","PPP2R2C"]
Coronary artery disease	2	["PPP2R3A","PPP2R2A"]
Metabolic syndrome	2	["PPP2R3A","PPP2R2C"]