PPP2R2B (protein phosphatase 2 regulatory subunit Bbeta)

Gene Gene information from NCBI Gene database.
Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID 5521
Gene name Protein phosphatase 2 regulatory subunit Bbeta
Gene symbol PPP2R2B
Synonyms (NCBI Gene)
B55BETAPP2AB55BETAPP2ABBETAPP2APR55BPP2APR55BETAPR2AB55BETAPR2ABBETAPR2APR55BETAPR52BPR55-BETAPR55BETASCA12
Chromosome 5
Chromosome location 5q32
Summary The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
miRNA miRNA information provided by mirtarbase database.
28
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (28)
miRTarBase ID miRNA Experiments Reference
MIRT044115 hsa-miR-30e-3p CLASH 23622248
MIRT454465 hsa-miR-548aa PAR-CLIP 23592263
MIRT454464 hsa-miR-548ap-3p PAR-CLIP 23592263
MIRT454463 hsa-miR-548t-3p PAR-CLIP 23592263
MIRT454461 hsa-miR-4779 PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (3)
Transcription factor Regulation Reference
CREB1 Activation 20533062
SP1 Activation 20533062
TFAP4 Repression 20533062
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene SNPs Transcription factors Other IDs Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000159 Component Protein phosphatase type 2A complex IBA
GO:0000159 Component Protein phosphatase type 2A complex IEA
GO:0005515 Function Protein binding IPI 17274953, 19156129, 21075311, 25816751, 26496610, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Transcription factors Other IDs Associated diseases
MIM HGNC e!Ensembl
604325 9305 ENSG00000156475
Protein Protein information from UniProt database.
Gene SNPs Transcription factors Other IDs Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q00005
Protein name Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PP2A subunit B isoform B55-beta) (PP2A subunit B isoform PR55-beta) (PP2A subunit B isoform R2-beta) (PP2A subunit B isoform beta)
Protein function The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is requir
Family and domains
Tissue specificity TISSUE SPECIFICITY: Brain.
Sequence 
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN
Sequence length 443
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Gene SNPs Transcription factors Other IDs Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (25)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMERS DISEASE — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATAXIA, SPINOCEREBELLAR — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (84)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoid Cystic Carcinoma Adenocarcinoma BEFREE 29275362
★★★★★
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder HPO_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Ataxia, Spinocerebellar Spinocerebellar Ataxia BEFREE 15080863, 19488825, 19659750, 25634432, 26077168
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ataxia, Spinocerebellar Spinocerebellar Ataxia CTD_human_DG 18940801
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder with Hyperactivity Attention deficit hyperactivity disorder Pubtator 27754487 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism Pubtator 36199823 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 31335320
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases of the Nervous System Autoimmune nervous system disorder Pubtator 31335320 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Blast Phase Blast phase chronic myelogenous leukemia LHGDN 16286244
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 20669227, 23034890, 24093668
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations