Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5522
Gene name	Protein phosphatase 2 regulatory subunit Bgamma
Gene symbol	PPP2R2C
Synonyms (NCBI Gene)	B55-GAMMAB55gammaIMYPNOIMYPNO1PR52PR55G
Chromosome	4
Chromosome location	4p16.1
Summary	The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021554	hsa-miR-142-3p	Microarray	17612493
MIRT1257566	hsa-miR-1284	CLIP-seq
MIRT1257567	hsa-miR-300	CLIP-seq
MIRT1257568	hsa-miR-3591-3p	CLIP-seq
MIRT1257569	hsa-miR-3613-3p	CLIP-seq
MIRT1257570	hsa-miR-3688-3p	CLIP-seq
MIRT1257571	hsa-miR-3691-3p	CLIP-seq
MIRT1257572	hsa-miR-381	CLIP-seq
MIRT1257573	hsa-miR-4261	CLIP-seq
MIRT1257574	hsa-miR-4506	CLIP-seq
MIRT1257575	hsa-miR-4666-3p	CLIP-seq
MIRT1257576	hsa-miR-548aa	CLIP-seq
MIRT1257577	hsa-miR-548p	CLIP-seq
MIRT1257578	hsa-miR-555	CLIP-seq
MIRT1257579	hsa-miR-561	CLIP-seq
MIRT1257580	hsa-miR-607	CLIP-seq
MIRT1257581	hsa-miR-942	CLIP-seq
MIRT1257582	hsa-miR-1207-5p	CLIP-seq
MIRT1257583	hsa-miR-1253	CLIP-seq
MIRT1257584	hsa-miR-24	CLIP-seq
MIRT1257585	hsa-miR-2467-3p	CLIP-seq
MIRT1257586	hsa-miR-2467-5p	CLIP-seq
MIRT1257587	hsa-miR-3665	CLIP-seq
MIRT1257588	hsa-miR-3919	CLIP-seq
MIRT1257589	hsa-miR-4736	CLIP-seq
MIRT1257590	hsa-miR-4756-3p	CLIP-seq
MIRT1257591	hsa-miR-4763-3p	CLIP-seq
MIRT1257592	hsa-miR-545	CLIP-seq
MIRT1257593	hsa-miR-610	CLIP-seq
MIRT1257594	hsa-miR-922	CLIP-seq
MIRT1257595	hsa-miR-1243	CLIP-seq
MIRT1257596	hsa-miR-1273f	CLIP-seq
MIRT1257597	hsa-miR-1290	CLIP-seq
MIRT1257598	hsa-miR-190	CLIP-seq
MIRT1257599	hsa-miR-190b	CLIP-seq
MIRT1257600	hsa-miR-198	CLIP-seq
MIRT1257601	hsa-miR-200b	CLIP-seq
MIRT1257602	hsa-miR-200c	CLIP-seq
MIRT1257603	hsa-miR-3134	CLIP-seq
MIRT1257604	hsa-miR-3167	CLIP-seq
MIRT1257571	hsa-miR-3691-3p	CLIP-seq
MIRT1257605	hsa-miR-369-3p	CLIP-seq
MIRT1257606	hsa-miR-374a	CLIP-seq
MIRT1257607	hsa-miR-374b	CLIP-seq
MIRT1257608	hsa-miR-429	CLIP-seq
MIRT1257609	hsa-miR-4487	CLIP-seq
MIRT1257574	hsa-miR-4506	CLIP-seq
MIRT1257610	hsa-miR-4753-5p	CLIP-seq
MIRT1257577	hsa-miR-548p	CLIP-seq
MIRT1257578	hsa-miR-555	CLIP-seq
MIRT1257611	hsa-miR-629	CLIP-seq
MIRT1257612	hsa-miR-876-5p	CLIP-seq
MIRT2075899	hsa-miR-2964a-3p	CLIP-seq
MIRT2302517	hsa-miR-1225-5p	CLIP-seq
MIRT2302518	hsa-miR-1226	CLIP-seq
MIRT2302519	hsa-miR-1262	CLIP-seq
MIRT2302520	hsa-miR-1914	CLIP-seq
MIRT2302521	hsa-miR-2113	CLIP-seq
MIRT2302522	hsa-miR-218	CLIP-seq
MIRT1257584	hsa-miR-24	CLIP-seq
MIRT1257585	hsa-miR-2467-3p	CLIP-seq
MIRT1257586	hsa-miR-2467-5p	CLIP-seq
MIRT2302523	hsa-miR-3140-3p	CLIP-seq
MIRT2302524	hsa-miR-3177-3p	CLIP-seq
MIRT2302525	hsa-miR-324-5p	CLIP-seq
MIRT2302526	hsa-miR-329	CLIP-seq
MIRT2302527	hsa-miR-362-3p	CLIP-seq
MIRT2302528	hsa-miR-3661	CLIP-seq
MIRT2302529	hsa-miR-3941	CLIP-seq
MIRT2302530	hsa-miR-4325	CLIP-seq
MIRT2302531	hsa-miR-4464	CLIP-seq
MIRT2302532	hsa-miR-4659a-5p	CLIP-seq
MIRT2302533	hsa-miR-4659b-5p	CLIP-seq
MIRT2302534	hsa-miR-466	CLIP-seq
MIRT2302535	hsa-miR-4672	CLIP-seq
MIRT2302536	hsa-miR-4701-3p	CLIP-seq
MIRT2302537	hsa-miR-4722-3p	CLIP-seq
MIRT2302538	hsa-miR-4733-3p	CLIP-seq
MIRT2302539	hsa-miR-4748	CLIP-seq
MIRT2302540	hsa-miR-4769-3p	CLIP-seq
MIRT2302541	hsa-miR-4773	CLIP-seq
MIRT1257592	hsa-miR-545	CLIP-seq
MIRT1257578	hsa-miR-555	CLIP-seq
MIRT2302542	hsa-miR-572	CLIP-seq
MIRT2302543	hsa-miR-603	CLIP-seq
MIRT2302544	hsa-miR-631	CLIP-seq
MIRT2302545	hsa-miR-636	CLIP-seq
MIRT1257594	hsa-miR-922	CLIP-seq
MIRT2302546	hsa-miR-1343	CLIP-seq
MIRT2302531	hsa-miR-4464	CLIP-seq
MIRT1257589	hsa-miR-4736	CLIP-seq
MIRT2302539	hsa-miR-4748	CLIP-seq
MIRT2302547	hsa-miR-657	CLIP-seq
MIRT2457064	hsa-miR-188-3p	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IEA
GO:0000159	Component	Protein phosphatase type 2A complex	NAS	10945473
GO:0005515	Function	Protein binding	IPI	19156129, 24126060, 25816751, 33961781
GO:0005829	Component	Cytosol	IBA
GO:0019888	Function	Protein phosphatase regulator activity	IBA
GO:0019888	Function	Protein phosphatase regulator activity	IEA
GO:0019888	Function	Protein phosphatase regulator activity	NAS	10945473

MIM	HGNC	e!Ensembl
605997	9306	ENSG00000074211

Q9Y2T4

Protein name

Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (IMYPNO1) (PP2A subunit B isoform B55-gamma) (PP2A subunit B isoform PR55-gamma) (PP2A subunit B isoform R2-gamma) (PP2A subunit B isoform gamma)

Protein function

The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment.

Family and domains

Sequence

MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH

Sequence length

447

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EMPHYSEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anorexia Nervosa	Anorexia nervosa	Pubtator	35013117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31541176	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20308991, 24387768		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	24387768	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	24126060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17592619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26796271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35013117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	31730496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30454882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	20601260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28253108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	24126060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17592619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26796271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23493267, 27261573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24126060, 25576648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	23493267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28525724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23493267, 24126060, 26395031, 27261573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37272097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26796271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32878513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	27082954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23493267, 27261573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23493267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23493267	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP2R2C (protein phosphatase 2 regulatory subunit Bgamma)