PPP2R3A (protein phosphatase 2 regulatory subunit B''alpha)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5523
• Gene name: Protein phosphatase 2 regulatory subunit B''alpha
• Gene symbol: PPP2R3A
• Synonyms (NCBI Gene): PPP2R3, PR130, PR72
• Chromosome: 3
• Chromosome location: 3q22.2-q22.3
• Summary: This gene encodes one of the regulatory subunits of the protein phosphatase 2. Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phos

miRNA Show/Hide all (294)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019482	hsa-miR-148b-3p	Microarray	17612493
MIRT649473	hsa-miR-4759	HITS-CLIP	23824327
MIRT649472	hsa-miR-3169	HITS-CLIP	23824327
MIRT649471	hsa-miR-8083	HITS-CLIP	23824327
MIRT621045	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT621044	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT621043	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649470	hsa-miR-3117-3p	HITS-CLIP	23824327
MIRT621045	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT621044	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT621043	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649473	hsa-miR-4759	HITS-CLIP	23824327
MIRT649472	hsa-miR-3169	HITS-CLIP	23824327
MIRT649471	hsa-miR-8083	HITS-CLIP	23824327
MIRT621045	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT621044	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT621043	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT649470	hsa-miR-3117-3p	HITS-CLIP	23824327
MIRT621045	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT621044	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT621043	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT1257635	hsa-miR-1183	CLIP-seq
MIRT1257636	hsa-miR-1202	CLIP-seq
MIRT1257637	hsa-miR-1208	CLIP-seq
MIRT1257638	hsa-miR-1263	CLIP-seq
MIRT1257639	hsa-miR-129-5p	CLIP-seq
MIRT1257640	hsa-miR-1321	CLIP-seq
MIRT1257641	hsa-miR-150	CLIP-seq
MIRT1257642	hsa-miR-181a	CLIP-seq
MIRT1257643	hsa-miR-181b	CLIP-seq
MIRT1257644	hsa-miR-181c	CLIP-seq
MIRT1257645	hsa-miR-181d	CLIP-seq
MIRT1257646	hsa-miR-3152-5p	CLIP-seq
MIRT1257647	hsa-miR-3156-5p	CLIP-seq
MIRT1257648	hsa-miR-3163	CLIP-seq
MIRT1257649	hsa-miR-3189-3p	CLIP-seq
MIRT1257650	hsa-miR-3194-5p	CLIP-seq
MIRT1257651	hsa-miR-3200-3p	CLIP-seq
MIRT1257652	hsa-miR-3202	CLIP-seq
MIRT1257653	hsa-miR-335	CLIP-seq
MIRT1257654	hsa-miR-362-5p	CLIP-seq
MIRT1257655	hsa-miR-3653	CLIP-seq
MIRT1257656	hsa-miR-3658	CLIP-seq
MIRT1257657	hsa-miR-3662	CLIP-seq
MIRT1257658	hsa-miR-3972	CLIP-seq
MIRT1257659	hsa-miR-409-5p	CLIP-seq
MIRT1257660	hsa-miR-410	CLIP-seq
MIRT1257661	hsa-miR-4262	CLIP-seq
MIRT1257662	hsa-miR-4270	CLIP-seq
MIRT1257663	hsa-miR-4280	CLIP-seq
MIRT1257664	hsa-miR-4282	CLIP-seq
MIRT1257665	hsa-miR-4438	CLIP-seq
MIRT1257666	hsa-miR-4441	CLIP-seq
MIRT1257667	hsa-miR-4452	CLIP-seq
MIRT1257668	hsa-miR-4471	CLIP-seq
MIRT1257669	hsa-miR-4533	CLIP-seq
MIRT1257670	hsa-miR-4699-5p	CLIP-seq
MIRT1257671	hsa-miR-4729	CLIP-seq
MIRT1257672	hsa-miR-4732-5p	CLIP-seq
MIRT1257673	hsa-miR-4739	CLIP-seq
MIRT1257674	hsa-miR-4756-5p	CLIP-seq
MIRT1257675	hsa-miR-4764-3p	CLIP-seq
MIRT1257676	hsa-miR-4774-3p	CLIP-seq
MIRT1257677	hsa-miR-500b	CLIP-seq
MIRT1257678	hsa-miR-5095	CLIP-seq
MIRT1257679	hsa-miR-512-3p	CLIP-seq
MIRT1257680	hsa-miR-545	CLIP-seq
MIRT1257681	hsa-miR-577	CLIP-seq
MIRT1257682	hsa-miR-579	CLIP-seq
MIRT1257683	hsa-miR-618	CLIP-seq
MIRT1257684	hsa-miR-628-5p	CLIP-seq
MIRT1257685	hsa-miR-106a	CLIP-seq
MIRT1257686	hsa-miR-106b	CLIP-seq
MIRT1257635	hsa-miR-1183	CLIP-seq
MIRT1257687	hsa-miR-1185	CLIP-seq
MIRT1257688	hsa-miR-1207-5p	CLIP-seq
MIRT1257637	hsa-miR-1208	CLIP-seq
MIRT1257689	hsa-miR-1244	CLIP-seq
MIRT1257690	hsa-miR-1252	CLIP-seq
MIRT1257638	hsa-miR-1263	CLIP-seq
MIRT1257691	hsa-miR-1265	CLIP-seq
MIRT1257692	hsa-miR-1271	CLIP-seq
MIRT1257693	hsa-miR-1273d	CLIP-seq
MIRT1257694	hsa-miR-1273e	CLIP-seq
MIRT1257695	hsa-miR-1275	CLIP-seq
MIRT1257696	hsa-miR-1284	CLIP-seq
MIRT1257697	hsa-miR-1343	CLIP-seq
MIRT1257698	hsa-miR-140-5p	CLIP-seq
MIRT1257699	hsa-miR-17	CLIP-seq
MIRT1257700	hsa-miR-182	CLIP-seq
MIRT1257701	hsa-miR-200b	CLIP-seq
MIRT1257702	hsa-miR-200c	CLIP-seq
MIRT1257703	hsa-miR-20a	CLIP-seq
MIRT1257704	hsa-miR-20b	CLIP-seq
MIRT1257705	hsa-miR-2861	CLIP-seq
MIRT1257706	hsa-miR-3119	CLIP-seq
MIRT1257707	hsa-miR-3134	CLIP-seq
MIRT1257708	hsa-miR-3150b-3p	CLIP-seq
MIRT1257647	hsa-miR-3156-5p	CLIP-seq
MIRT1257709	hsa-miR-3158-3p	CLIP-seq
MIRT1257710	hsa-miR-3192	CLIP-seq
MIRT1257651	hsa-miR-3200-3p	CLIP-seq
MIRT1257711	hsa-miR-3201	CLIP-seq
MIRT1257652	hsa-miR-3202	CLIP-seq
MIRT1257712	hsa-miR-323-3p	CLIP-seq
MIRT1257713	hsa-miR-325	CLIP-seq
MIRT1257714	hsa-miR-338-5p	CLIP-seq
MIRT1257715	hsa-miR-3545-3p	CLIP-seq
MIRT1257716	hsa-miR-3605-5p	CLIP-seq
MIRT1257717	hsa-miR-3609	CLIP-seq
MIRT1257718	hsa-miR-3671	CLIP-seq
MIRT1257719	hsa-miR-3674	CLIP-seq
MIRT1257720	hsa-miR-3679-5p	CLIP-seq
MIRT1257721	hsa-miR-3689a-3p	CLIP-seq
MIRT1257722	hsa-miR-3689c	CLIP-seq
MIRT1257723	hsa-miR-3691-3p	CLIP-seq
MIRT1257724	hsa-miR-382	CLIP-seq
MIRT1257725	hsa-miR-3923	CLIP-seq
MIRT1257726	hsa-miR-3925-3p	CLIP-seq
MIRT1257659	hsa-miR-409-5p	CLIP-seq
MIRT1257727	hsa-miR-429	CLIP-seq
MIRT1257728	hsa-miR-4294	CLIP-seq
MIRT1257729	hsa-miR-4303	CLIP-seq
MIRT1257730	hsa-miR-4423-5p	CLIP-seq
MIRT1257731	hsa-miR-4434	CLIP-seq
MIRT1257732	hsa-miR-4464	CLIP-seq
MIRT1257733	hsa-miR-4476	CLIP-seq
MIRT1257734	hsa-miR-4477a	CLIP-seq
MIRT1257735	hsa-miR-4493	CLIP-seq
MIRT1257736	hsa-miR-4495	CLIP-seq
MIRT1257737	hsa-miR-4516	CLIP-seq
MIRT1257669	hsa-miR-4533	CLIP-seq
MIRT1257738	hsa-miR-4649-3p	CLIP-seq
MIRT1257739	hsa-miR-4665-5p	CLIP-seq
MIRT1257740	hsa-miR-4680-5p	CLIP-seq
MIRT1257741	hsa-miR-4689	CLIP-seq
MIRT1257742	hsa-miR-4712-5p	CLIP-seq
MIRT1257743	hsa-miR-4728-5p	CLIP-seq
MIRT1257672	hsa-miR-4732-5p	CLIP-seq
MIRT1257744	hsa-miR-4736	CLIP-seq
MIRT1257745	hsa-miR-4748	CLIP-seq
MIRT1257746	hsa-miR-4763-3p	CLIP-seq
MIRT1257675	hsa-miR-4764-3p	CLIP-seq
MIRT1257747	hsa-miR-4781-3p	CLIP-seq
MIRT1257748	hsa-miR-4784	CLIP-seq
MIRT1257749	hsa-miR-4791	CLIP-seq
MIRT1257750	hsa-miR-4796-3p	CLIP-seq
MIRT1257751	hsa-miR-499-3p	CLIP-seq
MIRT1257752	hsa-miR-499a-3p	CLIP-seq
MIRT1257753	hsa-miR-508-5p	CLIP-seq
MIRT1257754	hsa-miR-519d	CLIP-seq
MIRT1257755	hsa-miR-544b	CLIP-seq
MIRT1257680	hsa-miR-545	CLIP-seq
MIRT1257756	hsa-miR-548ah	CLIP-seq
MIRT1257683	hsa-miR-618	CLIP-seq
MIRT1257757	hsa-miR-661	CLIP-seq
MIRT1257758	hsa-miR-770-5p	CLIP-seq
MIRT1257759	hsa-miR-93	CLIP-seq
MIRT1257760	hsa-miR-96	CLIP-seq
MIRT2075902	hsa-miR-103b	CLIP-seq
MIRT1257685	hsa-miR-106a	CLIP-seq
MIRT1257686	hsa-miR-106b	CLIP-seq
MIRT2075903	hsa-miR-1184	CLIP-seq
MIRT1257636	hsa-miR-1202	CLIP-seq
MIRT1257694	hsa-miR-1273e	CLIP-seq
MIRT1257695	hsa-miR-1275	CLIP-seq
MIRT2075904	hsa-miR-1304	CLIP-seq
MIRT1257699	hsa-miR-17	CLIP-seq
MIRT1257703	hsa-miR-20a	CLIP-seq
MIRT1257704	hsa-miR-20b	CLIP-seq
MIRT2075905	hsa-miR-3123	CLIP-seq
MIRT1257707	hsa-miR-3134	CLIP-seq
MIRT2075906	hsa-miR-3135	CLIP-seq
MIRT1257647	hsa-miR-3156-5p	CLIP-seq
MIRT1257650	hsa-miR-3194-5p	CLIP-seq
MIRT1257652	hsa-miR-3202	CLIP-seq
MIRT2075907	hsa-miR-3622a-3p	CLIP-seq
MIRT2075908	hsa-miR-3622b-3p	CLIP-seq
MIRT2075909	hsa-miR-3652	CLIP-seq
MIRT1257718	hsa-miR-3671	CLIP-seq
MIRT1257724	hsa-miR-382	CLIP-seq
MIRT2075910	hsa-miR-3925-5p	CLIP-seq
MIRT2075911	hsa-miR-3929	CLIP-seq
MIRT1257658	hsa-miR-3972	CLIP-seq
MIRT2075912	hsa-miR-4418	CLIP-seq
MIRT2075913	hsa-miR-4419b	CLIP-seq
MIRT2075914	hsa-miR-4430	CLIP-seq
MIRT1257731	hsa-miR-4434	CLIP-seq
MIRT2075915	hsa-miR-4478	CLIP-seq
MIRT1257737	hsa-miR-4516	CLIP-seq
MIRT1257669	hsa-miR-4533	CLIP-seq
MIRT1257739	hsa-miR-4665-5p	CLIP-seq
MIRT2075916	hsa-miR-4704-3p	CLIP-seq
MIRT1257672	hsa-miR-4732-5p	CLIP-seq
MIRT2075917	hsa-miR-4796-5p	CLIP-seq
MIRT1257751	hsa-miR-499-3p	CLIP-seq
MIRT1257752	hsa-miR-499a-3p	CLIP-seq
MIRT2075918	hsa-miR-509-3-5p	CLIP-seq
MIRT2075919	hsa-miR-509-5p	CLIP-seq
MIRT2075920	hsa-miR-514	CLIP-seq
MIRT2075921	hsa-miR-514b-3p	CLIP-seq
MIRT1257754	hsa-miR-519d	CLIP-seq
MIRT2075922	hsa-miR-520g	CLIP-seq
MIRT2075923	hsa-miR-520h	CLIP-seq
MIRT2075924	hsa-miR-589	CLIP-seq
MIRT2075925	hsa-miR-645	CLIP-seq
MIRT2075926	hsa-miR-891b	CLIP-seq
MIRT1257759	hsa-miR-93	CLIP-seq
MIRT1257685	hsa-miR-106a	CLIP-seq
MIRT1257686	hsa-miR-106b	CLIP-seq
MIRT1257687	hsa-miR-1185	CLIP-seq
MIRT1257636	hsa-miR-1202	CLIP-seq
MIRT1257689	hsa-miR-1244	CLIP-seq
MIRT1257691	hsa-miR-1265	CLIP-seq
MIRT2302548	hsa-miR-1305	CLIP-seq
MIRT1257698	hsa-miR-140-5p	CLIP-seq
MIRT1257699	hsa-miR-17	CLIP-seq
MIRT1257703	hsa-miR-20a	CLIP-seq
MIRT1257704	hsa-miR-20b	CLIP-seq
MIRT1257647	hsa-miR-3156-5p	CLIP-seq
MIRT1257650	hsa-miR-3194-5p	CLIP-seq
MIRT1257652	hsa-miR-3202	CLIP-seq
MIRT1257713	hsa-miR-325	CLIP-seq
MIRT1257714	hsa-miR-338-5p	CLIP-seq
MIRT1257716	hsa-miR-3605-5p	CLIP-seq
MIRT1257717	hsa-miR-3609	CLIP-seq
MIRT2075909	hsa-miR-3652	CLIP-seq
MIRT1257718	hsa-miR-3671	CLIP-seq
MIRT1257720	hsa-miR-3679-5p	CLIP-seq
MIRT2302549	hsa-miR-384	CLIP-seq
MIRT1257725	hsa-miR-3923	CLIP-seq
MIRT1257658	hsa-miR-3972	CLIP-seq
MIRT1257659	hsa-miR-409-5p	CLIP-seq
MIRT2075914	hsa-miR-4430	CLIP-seq
MIRT1257735	hsa-miR-4493	CLIP-seq
MIRT1257736	hsa-miR-4495	CLIP-seq
MIRT1257669	hsa-miR-4533	CLIP-seq
MIRT1257750	hsa-miR-4796-3p	CLIP-seq
MIRT2302550	hsa-miR-498	CLIP-seq
MIRT2302551	hsa-miR-513a-3p	CLIP-seq
MIRT1257754	hsa-miR-519d	CLIP-seq
MIRT1257755	hsa-miR-544b	CLIP-seq
MIRT1257680	hsa-miR-545	CLIP-seq
MIRT1257756	hsa-miR-548ah	CLIP-seq
MIRT2302552	hsa-miR-576-3p	CLIP-seq
MIRT2302553	hsa-miR-767-5p	CLIP-seq
MIRT1257759	hsa-miR-93	CLIP-seq
MIRT1257685	hsa-miR-106a	CLIP-seq
MIRT1257686	hsa-miR-106b	CLIP-seq
MIRT1257636	hsa-miR-1202	CLIP-seq
MIRT1257699	hsa-miR-17	CLIP-seq
MIRT1257703	hsa-miR-20a	CLIP-seq
MIRT1257704	hsa-miR-20b	CLIP-seq
MIRT1257658	hsa-miR-3972	CLIP-seq
MIRT1257659	hsa-miR-409-5p	CLIP-seq
MIRT1257754	hsa-miR-519d	CLIP-seq
MIRT1257759	hsa-miR-93	CLIP-seq
MIRT1257694	hsa-miR-1273e	CLIP-seq
MIRT1257695	hsa-miR-1275	CLIP-seq
MIRT2457065	hsa-miR-128	CLIP-seq
MIRT2457066	hsa-miR-1909	CLIP-seq
MIRT2457067	hsa-miR-193a-5p	CLIP-seq
MIRT1257707	hsa-miR-3134	CLIP-seq
MIRT2075906	hsa-miR-3135	CLIP-seq
MIRT2457068	hsa-miR-3194-3p	CLIP-seq
MIRT1257711	hsa-miR-3201	CLIP-seq
MIRT1257724	hsa-miR-382	CLIP-seq
MIRT2457069	hsa-miR-431	CLIP-seq
MIRT1257734	hsa-miR-4477a	CLIP-seq
MIRT2457070	hsa-miR-4504	CLIP-seq
MIRT1257739	hsa-miR-4665-5p	CLIP-seq
MIRT2457071	hsa-miR-4672	CLIP-seq
MIRT1257749	hsa-miR-4791	CLIP-seq
MIRT2457072	hsa-miR-615-5p	CLIP-seq
MIRT2075917	hsa-miR-4796-5p	CLIP-seq
MIRT1257751	hsa-miR-499-3p	CLIP-seq
MIRT1257752	hsa-miR-499a-3p	CLIP-seq
MIRT1257694	hsa-miR-1273e	CLIP-seq
MIRT1257695	hsa-miR-1275	CLIP-seq
MIRT1257707	hsa-miR-3134	CLIP-seq
MIRT1257711	hsa-miR-3201	CLIP-seq
MIRT1257654	hsa-miR-362-5p	CLIP-seq
MIRT1257724	hsa-miR-382	CLIP-seq
MIRT1257734	hsa-miR-4477a	CLIP-seq
MIRT1257739	hsa-miR-4665-5p	CLIP-seq
MIRT1257749	hsa-miR-4791	CLIP-seq
MIRT2075917	hsa-miR-4796-5p	CLIP-seq
MIRT1257751	hsa-miR-499-3p	CLIP-seq
MIRT1257752	hsa-miR-499a-3p	CLIP-seq
MIRT1257677	hsa-miR-500b	CLIP-seq
MIRT2599191	hsa-miR-501-5p	CLIP-seq
MIRT2302552	hsa-miR-576-3p	CLIP-seq
MIRT2599192	hsa-miR-633	CLIP-seq
MIRT2302553	hsa-miR-767-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IDA	15687260, 17055435
GO:0000159	Component	Protein phosphatase type 2A complex	ISS	1849734
GO:0001754	Process	Eye photoreceptor cell differentiation	IGI	15687260
GO:0001756	Process	Somitogenesis	IBA
GO:0001756	Process	Somitogenesis	IGI	15687260
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	9847399, 15687260, 16567647, 30595372
GO:0006470	Process	Protein dephosphorylation	ISS	1849734
GO:0007525	Process	Somatic muscle development	IBA
GO:0007525	Process	Somatic muscle development	IGI	15687260
GO:0019888	Function	Protein phosphatase regulator activity	IBA
GO:0019888	Function	Protein phosphatase regulator activity	TAS	8392071
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	15687260
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	15687260
GO:0046872	Function	Metal ion binding	IEA
GO:0060828	Process	Regulation of canonical Wnt signaling pathway	IBA
GO:0061053	Process	Somite development	ISS	16567647
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IGI	15687260
GO:0090249	Process	Regulation of cell migration involved in somitogenic axis elongation	IBA
GO:0090249	Process	Regulation of cell migration involved in somitogenic axis elongation	IGI	15687260
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	16567647

Other IDs

• MIM: 604944
• HGNC: 9307
• e!Ensembl: ENSG00000073711

Protein

• UniProt ID: Q06190
• Protein name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha (PP2A subunit B isoform PR72/PR130) (PP2A subunit B isoform R3 isoform) (PP2A subunit B isoforms B''-PR72/PR130) (PP2A subunit B isoforms B72/B130) (Serine/threonine-protein phos
• Protein function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment.
• PDB: 4I5J , 4I5K
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	900 → 1002	EF-hand domain pair	Domain
  PF17958	EF-hand_13	796 → 885	EF-hand domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, muscle and kidney.
• Sequence:

  MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGIDCIVVHHSVCADLLHIPV
  SQFKDADLNSMFLPHENGLSSAEGDYPQQAFTGIPRVKRGSTFQNTYNLKDIAGEAISFA
  SGKIKEFSFEKLKNSNHAAYRKGRKVKSDSFNRRSVDLDLLCGHYNNDGNAPSFGLLRSS
  SVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
  EDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLASYLKKLPFEFMQSG
  NNEALDLTELISNMPSLQLTPFSPVFGTEQPPKYEDVVQLSASDSGRFQTIELQNDKPNS
  RKMDTVQSIPNNSTNSLYNLEVNDPRTLKAVQVQSQSLTMNPLENVSSDDLMETLYIEEE
  SDGKKALDKGQKTENGPSHELLKVNEHRAEFPEHATHLKKCPTPMQNEIGKIFEKSFVNL
  PKEDCKSKVSKFEEGDQRDFTNSSSQEEIDKLLMDLESFSQKMETSLREPLAKGKNSNFL
  NSHSQLTGQTLVDLEPKSKVSSPIEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIED
  FAQELVECKSSRGSLSQEKEMMQILQETLTTSSQANLSVCRSPVGDKAKDTTSAVLIQQT
  PEVIKIQNKPEKKPGTPLPPPATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPD
  TCSNHEQTLSRIETAFMDIEEQKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTA
  QSFIAMWRKLLNNHHDDASKFICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPE
  FHSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHF
  YVIYCKFWELDTDHDLYISQADLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYAD
  FVWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHD
  LLCQMLDLVKPAVDGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDG
  PEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEK
  CGKLQSVDEE

• Sequence length: 1150

Pathways

KEGG Pathway

mRNA surveillance pathway

Sphingolipid signaling pathway

PI3K-Akt signaling pathway

AMPK signaling pathway

Adrenergic signaling in cardiomyocytes

T cell receptor signaling pathway

Dopaminergic synapse

Human papillomavirus infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (23)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	29892015, 30061737, 30061737, 35872910, 36653681, 39537608	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	36474045	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	36266505	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	40195560	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	33893285	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	33532862	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	29255261	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPP2R3A-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764, 33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	19430199	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35945177	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19430199		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	19430199	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19430199	Associate	★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	26945059	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31647192		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31647192		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31647192		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31647192		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35077391	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	33635380	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CYTH1 3 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation), GWAS catalog (Heart failure) Related via 3 shared evidence sources. HIP1R 3 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation), GWAS catalog (Heart failure) Related via 3 shared evidence sources. USP3 3 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation), GWAS catalog (Heart failure) Related via 3 shared evidence sources. PPP2R3C 6 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse Related via 6 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. HSF2 2 shared evidence sourcesCTD (Atrial fibrillation), Disgenet (Atrial fibrillation) Related via 2 shared evidence sources.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CYTH1	0	[]	0	[]	3	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Heart failure)"]
HIP1R	0	[]	0	[]	3	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Heart failure)"]
USP3	0	[]	0	[]	3	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)","GWAS catalog (Heart failure)"]
PPP2R3C	0	[]	6	["mRNA surveillance pathway","Sphingolipid signaling pathway","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse"]	0	[]
HSF2	0	[]	0	[]	2	["CTD (Atrial fibrillation)","Disgenet (Atrial fibrillation)"]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 2 of 5 related genesCYTH1, USP3 Ulcerative colitis Linked via 2 of 5 related genesCYTH1, PPP2R3C Insomnia Linked via 1 of 5 related genesHIP1R Parkinson disease Linked via 1 of 5 related genesHIP1R Obstructive pulmonary disease Linked via 1 of 5 related genesUSP3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	2	["CYTH1","USP3"]
Ulcerative colitis	2	["CYTH1","PPP2R3C"]
Insomnia	1	["HIP1R"]
Parkinson disease	1	["HIP1R"]
Obstructive pulmonary disease	1	["USP3"]