ZC3H11B (zinc finger CCCH-type containing 11B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 643136
Gene name Zinc finger CCCH-type containing 11B
Gene symbol ZC3H11B
Synonyms (NCBI Gene)
ZC3HDC11B
Chromosome 1
Chromosome location 1q41
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT016739 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0008270 Function Zinc ion binding IEA
GO:0016973 Process Poly(A)+ mRNA export from nucleus IBA
GO:0046872 Function Metal ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GTU1
Protein name Zinc finger CCCH domain-containing protein 11B
Protein function May play a role in mRNA transport.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15663 zf-CCCH_3 1 → 110 Zinc-finger containing family Family
Sequence 
MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRRVCRFRHMEIDKK
RSEIPCYWENQPTGCQKLNCVFHHNRGRYVDGLFLPPSKSVLPTVPESPEEEVKASQLSV
QQNKLSVQSNTSPQLRSVMKVESSENVPSPKHPPVVINAADDDEDDDDQFSEEGDETKTP
TLQPTPEVHNGLRVTSVRKPAVNIKQGECLHFGIKTLEEIKSKKMKEKSEEQGEGSSGVS
SLLLHPEPVPGPEKENVRTVVRTVTLSTKQGEEPLVRLGLTETLGKRKFSTGGDSDPPLK
RSLAQRLGKKVEAPETNTDETPKKAQVSKSLKERLGMSADPNNEDATDKVNKVGEIHVKT
LEEMLLERASQKHGESQTKLKTEGPSKTDDSTSGARSSSTIRIKTFSEVLAEEEHRQQEA
ERQKSKKDTTCIKLKTDSEIKKTVVLPPIVASKGQSEEPAGKTKSMQEVHMKTVEEIKLE
KALRVQQSSESSTSSPSQHEATPGARLLLRITKRTWRKEEKKLQEGNEVDFLSRVRMEAT
EASVETTGVDITKIQVKRCEIMRETRMQKQQEREKSVLTPLQGDVASCNTQVAEKPVLTA
VPGITWHLTKQLPTKSSQKVEVETSGIADSLLNVKWSAQTLEKRGEAKPTVNVKQSVVKV
VSSPKLAPKRKAVEMHPAVTAAVKPLSSSSVLQEPPAKKAAVDAVVLLDSEDKSVTVPEA
ENPRDSLVLPPTQSSSDSSPPEVSGPSSSQMSMKTRRLSSASTGKPPLSVEDDFEKLTWE
ISGGKLEAEIDLDPGKDEDDLPLEL
Sequence length 805
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (10)
Phenotype Name Clinical Significance Source Reference Evidence Score
CORNEAL ASTIGMATISM — GWAS catalog 30306274
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS — GWAS catalog 39024449
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERTENSION — GWAS catalog 33230300
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME — GWAS catalog 39349817
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA — GWAS catalog 37386247
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (7)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anisometropia Anisometropia Pubtator 37266952 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Astigmatism Astigmatism Pubtator 30306274 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Glaucoma Glaucoma Pubtator 31816047 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Myopia Myopia BEFREE 30306274, 31300455
★★★★★
★☆☆☆☆
Found in Text Mining only
Regular astigmatism - corneal Corneal astigmatism BEFREE 30306274
★★★★★
★☆☆☆☆
Found in Text Mining only
Retinal Detachment Retinal detachment Pubtator 31816047 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Severe myopia Myopia BEFREE 26485405
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CCSER1 2 shared diseasesDiabetes mellitus, Otosclerosis 2 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Otosclerosis) Related via 2 shared diseases including Diabetes mellitus, Otosclerosis — evidence mostly GWAS catalog. KCNU1 2 shared diseasesCorneal astigmatism, Diabetes mellitus 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Diabetes mellitus) Related via 2 shared diseases including Corneal astigmatism, Diabetes mellitus — evidence mostly GWAS catalog. MAML2 2 shared diseasesCorneal astigmatism, Otosclerosis 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Otosclerosis) Related via 2 shared diseases including Corneal astigmatism, Otosclerosis — evidence mostly GWAS catalog. NYAP2 2 shared diseasesCorneal astigmatism, Diabetes mellitus 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Diabetes mellitus) Related via 2 shared diseases including Corneal astigmatism, Diabetes mellitus — evidence mostly GWAS catalog. SMAD3 2 shared diseasesCorneal astigmatism, Otosclerosis 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Otosclerosis) Related via 2 shared diseases including Corneal astigmatism, Otosclerosis — evidence mostly GWAS catalog.
Breast cancer Linked via 4 of 5 related genesCCSER1, KCNU1, NYAP2, SMAD3 Scoliosis Linked via 3 of 5 related genesCCSER1, MAML2, NYAP2 Schizophrenia Linked via 3 of 5 related genesKCNU1, MAML2, NYAP2 Central nervous system cancer Linked via 2 of 5 related genesCCSER1, MAML2 Kidney disease Linked via 2 of 5 related genesCCSER1, NYAP2