CCSER1 (coiled-coil serine rich protein 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 401145 |
| Gene name | Coiled-coil serine rich protein 1 |
| Gene symbol | CCSER1 |
| Synonyms (NCBI Gene) |
FAM190A
|
| Chromosome | 4 |
| Chromosome location | 4q22.1 |
|
miRNA
miRNA information provided by mirtarbase database.
2
|
|||||||||||||
|
|||||||||||||
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9C0I3 |
| Protein name | Serine-rich coiled-coil domain-containing protein 1 (Coiled-coil serine-rich protein 1) |
| Family and domains | |
| Sequence |
MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRR |
| Sequence length | 900 |
| Interactions | View interactions |
|
Associated diseases
Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Evidence Score:
★☆☆☆☆ Gene-disease association found in Text Mining only
★★☆☆☆ Found in Text Mining and Unknown/Other Associations
★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources
★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Related Genes
Genes most often co-reported with CCSER1 across shared curated disease and pathway associations.
5
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CCSER1 (see Related Genes above), that are NOT already directly curated for CCSER1 itself -- a lead worth checking, not a confirmed association.
5
|
|