NYAP2 (neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57624
Gene name Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 2
Gene symbol NYAP2
Synonyms (NCBI Gene)
KIAA1486
Chromosome 2
Chromosome location 2q36.3
miRNA miRNA information provided by mirtarbase database.
42 Show/Hide all (42)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT634509 hsa-miR-1306-5p HITS-CLIP 23824327
MIRT634508 hsa-miR-6890-3p HITS-CLIP 23824327
MIRT634507 hsa-miR-6736-3p HITS-CLIP 23824327
MIRT634506 hsa-miR-6840-3p HITS-CLIP 23824327
MIRT634505 hsa-miR-1915-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 33961781
GO:0043491 Process Phosphatidylinositol 3-kinase/protein kinase B signal transduction IBA
GO:0043491 Process Phosphatidylinositol 3-kinase/protein kinase B signal transduction IEA
GO:0043491 Process Phosphatidylinositol 3-kinase/protein kinase B signal transduction ISS
GO:0048812 Process Neuron projection morphogenesis IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
615478 29291 ENSG00000144460
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P242
Protein name Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2
Protein function Activates PI3K and concomitantly recruits the WAVE1 complex to the close vicinity of PI3K and regulates neuronal morphogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15439 NYAP_N 56 → 431 Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter Family
PF15452 NYAP_C 467 → 653 Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter Family
Sequence 
MISSKMMSSNPEEDPLDTFLQYIEDMGMKAYDGLVIQNASDIARENDRLRNETNLAYLKE
KNEKRRRQEEAIKRIGGEVGRGHEGSYVGKHFRMGFMTMPAPQDRLPHPCSSGFSVRSQS
LHSVGGTDDDSSCGSRRQPPPKPKRDPSTKLSTSSETVSSTAASKSGKTPERTEASAKPR
PHSDEYSKKIPPPKPKRNPNTQLSTSFDETYIKKHGPRRTSLPRDSSLSQMGSPAGDPEE
EEPVYIEMVGNILRDFRKEDDDQSEAVYEEMKYPIFDDLGQDAKCDFDHHSCSSQCATPT
VPDLDFAKASVPCPPKGLLCDIPPPFPNLLSHRPPLLVFPPAPVHCSPNSDESPLTPLEV
TKLPVLENVSYMKQPAGASPSTLPSHVPGHAKLEKEQAAALGPASATPALSSSPPPPSTL
YRTQSPHGYPKSHSTSPSPVSMGRSLTPLSLKRPPPYDAVHSGSLSRSSPSVPHSTPRPV
SQDGAKMVNAAVNTYGAAPGGSRSRTPTSPLEELTSLFSSGRSLLRKSSSGRRSKEPAEK
STEELKVRSHSTEPLPKLDNKERGHHGASSSREPVKAQEWDGTPGTPVVTSRLGRCSVSP
TLLAGNHSSEPKVSCKLGRSASTSGVPPPSVTPLRQSSDLQQSQVPSSLANRD
Sequence length 653
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
55
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (55)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 34743297
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AORTIC ATHEROSCLEROSIS — GWAS catalog 39024449
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 18937294, 34446935
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CANCER — GWAS catalog 29059683, 32139696
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA — GWAS catalog 29059683, 32139696
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autism Spectrum Disorder Autism Pubtator 28281572 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
COBLL1 6 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic neuropathy, Diabetic retinopathy, Hyperlipidemia, Diabetic nephropathy type 2 8 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Hyperlipidemia), GWAS catalog (Myocardial ischemia), GWAS catalog (Nonalcoholic fatty liver disease), GWAS catalog (Diabetic nephropathy type 2) Related via 6 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. GPSM1 5 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic neuropathy, Diabetic retinopathy, Diabetic nephropathy type 2 5 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Diabetic nephropathy type 2) Related via 5 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. SLC30A8 5 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic neuropathy, Diabetic retinopathy, Diabetic nephropathy type 2 6 shared evidence sourcesGWAS catalog (Kidney disease), GWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Diabetic nephropathy type 2) Related via 5 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. HMG20A 5 shared diseasesDiabetes mellitus, Diabetic eye disease, Diabetic neuropathy, Diabetic retinopathy, Diabetic nephropathy type 2 5 shared evidence sourcesGWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Diabetic nephropathy type 2) Related via 5 shared diseases including Diabetes mellitus, Diabetic eye disease — evidence mostly GWAS catalog. IGF2BP2 7 shared diseasesCervical cancer, Diabetes mellitus, Diabetic eye disease, Diabetic neuropathy, Diabetic polyneuropathy, Diabetic retinopathy, Diabetic nephropathy type 2 8 shared evidence sourcesGWAS catalog (Cervical cancer), GWAS catalog (Diabetes mellitus), GWAS catalog (Diabetic eye disease), GWAS catalog (Diabetic neuropathy), GWAS catalog (Diabetic polyneuropathy), GWAS catalog (Diabetic retinopathy), GWAS catalog (Stroke), GWAS catalog (Diabetic nephropathy type 2) Related via 7 shared diseases including Cervical cancer, Diabetes mellitus — evidence mostly GWAS catalog.
Psoriasis Linked via 3 of 5 related genesCOBLL1, SLC30A8, IGF2BP2 Uterine fibroid Linked via 3 of 5 related genesCOBLL1, HMG20A, IGF2BP2 Gestational diabetes Linked via 2 of 5 related genesSLC30A8, IGF2BP2 Cleft lip and palate Linked via 1 of 5 related genesCOBLL1 Ankylosing spondylitis Linked via 1 of 5 related genesGPSM1