Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	26086
Gene name	G protein signaling modulator 1
Gene symbol	GPSM1
Synonyms (NCBI Gene)	AGS3
Chromosome	9
Chromosome location	9q34.3
Summary	G-protein signaling modulators (GPSMs) play diverse functional roles through their interaction with G-protein subunits. This gene encodes a receptor-independent activator of G protein signaling, which is one of several factors that influence the basal act

53 Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039937	hsa-miR-615-3p	CLASH	23622248
MIRT1032372	hsa-miR-1266	CLIP-seq
MIRT1032373	hsa-miR-1307	CLIP-seq
MIRT1032374	hsa-miR-1908	CLIP-seq
MIRT1032375	hsa-miR-3127-5p	CLIP-seq
MIRT1032376	hsa-miR-3918	CLIP-seq
MIRT1032377	hsa-miR-4446-3p	CLIP-seq
MIRT1032378	hsa-miR-4518	CLIP-seq
MIRT1032379	hsa-miR-663	CLIP-seq
MIRT1032380	hsa-miR-3940-5p	CLIP-seq
MIRT1032381	hsa-miR-3978	CLIP-seq
MIRT1032382	hsa-miR-4507	CLIP-seq
MIRT1032383	hsa-miR-635	CLIP-seq
MIRT1032384	hsa-miR-711	CLIP-seq
MIRT1032385	hsa-miR-1275	CLIP-seq
MIRT1032386	hsa-miR-3122	CLIP-seq
MIRT1032387	hsa-miR-3130-3p	CLIP-seq
MIRT1032388	hsa-miR-3689a-3p	CLIP-seq
MIRT1032389	hsa-miR-3689c	CLIP-seq
MIRT1032390	hsa-miR-3913-5p	CLIP-seq
MIRT1032391	hsa-miR-4290	CLIP-seq
MIRT1032392	hsa-miR-4447	CLIP-seq
MIRT1032393	hsa-miR-4472	CLIP-seq
MIRT1032394	hsa-miR-4481	CLIP-seq
MIRT1032395	hsa-miR-4525	CLIP-seq
MIRT1032396	hsa-miR-4643	CLIP-seq
MIRT1032397	hsa-miR-4665-5p	CLIP-seq
MIRT1032398	hsa-miR-4687-5p	CLIP-seq
MIRT1032399	hsa-miR-4717-3p	CLIP-seq
MIRT1032400	hsa-miR-4721	CLIP-seq
MIRT1032401	hsa-miR-4723-5p	CLIP-seq
MIRT1032402	hsa-miR-4745-5p	CLIP-seq
MIRT1032403	hsa-miR-625	CLIP-seq
MIRT1032404	hsa-miR-642b	CLIP-seq
MIRT2006259	hsa-miR-214	CLIP-seq
MIRT2006260	hsa-miR-3619-5p	CLIP-seq
MIRT2006261	hsa-miR-761	CLIP-seq
MIRT2388688	hsa-miR-1291	CLIP-seq
MIRT2542618	hsa-miR-1297	CLIP-seq
MIRT2542619	hsa-miR-181a	CLIP-seq
MIRT2542620	hsa-miR-181b	CLIP-seq
MIRT2542621	hsa-miR-181c	CLIP-seq
MIRT2542622	hsa-miR-181d	CLIP-seq
MIRT2542623	hsa-miR-26a	CLIP-seq
MIRT2542624	hsa-miR-26b	CLIP-seq
MIRT2542625	hsa-miR-3942-5p	CLIP-seq
MIRT2542626	hsa-miR-4262	CLIP-seq
MIRT2542627	hsa-miR-4465	CLIP-seq
MIRT2542628	hsa-miR-4703-5p	CLIP-seq
MIRT2542629	hsa-miR-4706	CLIP-seq
MIRT2542630	hsa-miR-4749-5p	CLIP-seq
MIRT2542631	hsa-miR-521	CLIP-seq
MIRT2542632	hsa-miR-744	CLIP-seq

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IBA
GO:0000139	Component	Golgi membrane	IDA	12642577
GO:0000139	Component	Golgi membrane	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IBA
GO:0005092	Function	GDP-dissociation inhibitor activity	IBA
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	11024022
GO:0005515	Function	Protein binding	IPI	16458856, 18566450, 22074847, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	12642577
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	18566450
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IDA	18566450
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IDA	12642577
GO:0030154	Process	Cell differentiation	IEA
GO:0030695	Function	GTPase regulator activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	16458856, 22074847
GO:0034260	Process	Negative regulation of GTPase activity	IDA	11024022
GO:1905098	Process	Negative regulation of guanyl-nucleotide exchange factor activity	IDA	11024022

MIM	HGNC	e!Ensembl
609491	17858	ENSG00000160360

Q86YR5

Protein name

G-protein-signaling modulator 1 (Activator of G-protein signaling 3)

Protein function

Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02188	GoLoco	496 → 517	GoLoco motif	Motif
PF02188	GoLoco	597 → 618	GoLoco motif	Motif
PF02188	GoLoco	549 → 569	GoLoco motif	Motif
PF02188	GoLoco	631 → 652	GoLoco motif	Motif
PF13424	TPR_12	208 → 281		Repeat
PF13424	TPR_12	247 → 321		Repeat
PF13424	TPR_12	104 → 163		Repeat
PF13424	TPR_12	285 → 361		Repeat
PF13424	TPR_12	187 → 241		Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in intestinal cells. {ECO:0000269|PubMed:12642577}.

Sequence

MAGPAPPVADELPGPAARRLYSRMEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPPD
VRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAK
EFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTYT
LLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQ
EIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSAETWDLL
RLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRKYQEGPDAERRPREGSHSPLDSADVRV
HVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQP
SMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFF
NMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGA
GGPPEPQQQCQPGAS

Sequence length

675

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cocaine addiction	G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (12)
ANKYLOSING SPONDYLITIS	—	GWAS catalog	23749187	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	36474045, 38062574	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	39792054	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	33532862, 34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	23945395, 26818947, 28869590, 29632382, 30297969, 30595370, 30718926, 31118516, 32499647, 32514122, 32541925, 34594039, 35551307, 38062574, 38374256, 38685053, 39024449, 39379762, 40465716	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	37262302	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (18)
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31215992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	23749187		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12642577, 25774687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	20488951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Kidney Diseases	Cystic Kidney Disease	BEFREE	20488951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	29947923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	23945395, 26818947, 28869590, 29632382, 30595370, 30718926, 31118516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	23945395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	20488951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31215992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19940363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24307516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19940363, 25812748, 31215992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31215992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31215992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25812748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36609218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	36609218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ARPIN-AP3S2	4	["Diabetes mellitus","Diabetic eye disease","Diabetic neuropathy","Diabetic retinopathy"]	[]	4	["GWAS catalog (Diabetes mellitus)","GWAS catalog (Diabetic eye disease)","GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)"]
HMG20A	5	["Diabetes mellitus","Diabetic eye disease","Diabetic neuropathy","Diabetic retinopathy","Diabetic nephropathy type 2"]	[]	5	["GWAS catalog (Diabetes mellitus)","GWAS catalog (Diabetic eye disease)","GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)","GWAS catalog (Diabetic nephropathy type 2)"]
CDC123	4	["Diabetes mellitus","Diabetic eye disease","Diabetic neuropathy","Diabetic retinopathy"]	[]	4	["GWAS catalog (Diabetes mellitus)","GWAS catalog (Diabetic eye disease)","GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)"]
COBLL1	5	["Diabetes mellitus","Diabetic eye disease","Diabetic neuropathy","Diabetic retinopathy","Diabetic nephropathy type 2"]	[]	5	["GWAS catalog (Diabetes mellitus)","GWAS catalog (Diabetic eye disease)","GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)","GWAS catalog (Diabetic nephropathy type 2)"]
SLC30A8	5	["Diabetes mellitus","Diabetic eye disease","Diabetic neuropathy","Diabetic retinopathy","Diabetic nephropathy type 2"]	[]	5	["GWAS catalog (Diabetes mellitus)","GWAS catalog (Diabetic eye disease)","GWAS catalog (Diabetic neuropathy)","GWAS catalog (Diabetic retinopathy)","GWAS catalog (Diabetic nephropathy type 2)"]

GPSM1 (G protein signaling modulator 1)

Bookmark This Gene