Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8078
Gene name	Ubiquitin specific peptidase 5
Gene symbol	USP5
Synonyms (NCBI Gene)	ISOT
Chromosome	12
Chromosome location	12p13.31
Summary	Ubiquitin (see MIM 191339)-dependent proteolysis is a complex pathway of protein metabolism implicated in such diverse cellular functions as maintenance of chromatin structure, receptor function, and degradation of abnormal proteins. A late step of the pr

120 Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022686	hsa-miR-124-3p	Microarray	18668037
MIRT028484	hsa-miR-30a-5p	Proteomics	18668040
MIRT042352	hsa-miR-484	CLASH	23622248
MIRT037909	hsa-miR-455-3p	CLASH	23622248
MIRT035949	hsa-miR-1180-3p	CLASH	23622248
MIRT052708	hsa-miR-1260b	CLASH	23622248
MIRT697755	hsa-miR-96-5p	HITS-CLIP	23313552
MIRT697754	hsa-miR-1271-5p	HITS-CLIP	23313552
MIRT697753	hsa-miR-182-5p	HITS-CLIP	23313552
MIRT697752	hsa-miR-23c	HITS-CLIP	23313552
MIRT697751	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT697750	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT697749	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT697747	hsa-miR-8080	HITS-CLIP	23313552
MIRT697748	hsa-miR-3919	HITS-CLIP	23313552
MIRT697746	hsa-miR-1250-3p	HITS-CLIP	23313552
MIRT697745	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT697744	hsa-miR-1256	HITS-CLIP	23313552
MIRT697743	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT697742	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT697741	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT697739	hsa-miR-4642	HITS-CLIP	23313552
MIRT697740	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT697748	hsa-miR-3919	PAR-CLIP	26701625
MIRT697755	hsa-miR-96-5p	HITS-CLIP	23313552
MIRT697754	hsa-miR-1271-5p	HITS-CLIP	23313552
MIRT697753	hsa-miR-182-5p	HITS-CLIP	23313552
MIRT697752	hsa-miR-23c	HITS-CLIP	23313552
MIRT697751	hsa-miR-23a-3p	HITS-CLIP	23313552
MIRT697750	hsa-miR-130a-5p	HITS-CLIP	23313552
MIRT697749	hsa-miR-23b-3p	HITS-CLIP	23313552
MIRT697747	hsa-miR-8080	HITS-CLIP	23313552
MIRT697748	hsa-miR-3919	HITS-CLIP	23313552
MIRT697746	hsa-miR-1250-3p	HITS-CLIP	23313552
MIRT697745	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT697744	hsa-miR-1256	HITS-CLIP	23313552
MIRT697743	hsa-miR-223-5p	HITS-CLIP	23313552
MIRT697742	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT697741	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT697739	hsa-miR-4642	HITS-CLIP	23313552
MIRT697740	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT1480258	hsa-miR-1271	CLIP-seq
MIRT1480259	hsa-miR-1470	CLIP-seq
MIRT1480260	hsa-miR-182	CLIP-seq
MIRT1480261	hsa-miR-1827	CLIP-seq
MIRT1480262	hsa-miR-23a	CLIP-seq
MIRT1480263	hsa-miR-23b	CLIP-seq
MIRT1480264	hsa-miR-3616-3p	CLIP-seq
MIRT1480265	hsa-miR-4446-5p	CLIP-seq
MIRT1480266	hsa-miR-4459	CLIP-seq
MIRT1480267	hsa-miR-4667-3p	CLIP-seq
MIRT1480268	hsa-miR-4722-5p	CLIP-seq
MIRT1480269	hsa-miR-4755-5p	CLIP-seq
MIRT1480270	hsa-miR-4779	CLIP-seq
MIRT1480271	hsa-miR-4787-5p	CLIP-seq
MIRT1480272	hsa-miR-615-5p	CLIP-seq
MIRT1480273	hsa-miR-642a	CLIP-seq
MIRT1480274	hsa-miR-940	CLIP-seq
MIRT1480275	hsa-miR-96	CLIP-seq
MIRT1480267	hsa-miR-4667-3p	CLIP-seq
MIRT2364808	hsa-miR-1247	CLIP-seq
MIRT1480261	hsa-miR-1827	CLIP-seq
MIRT2364809	hsa-miR-2355-5p	CLIP-seq
MIRT1480264	hsa-miR-3616-3p	CLIP-seq
MIRT2364810	hsa-miR-370	CLIP-seq
MIRT1480266	hsa-miR-4459	CLIP-seq
MIRT2364811	hsa-miR-4499	CLIP-seq
MIRT2364812	hsa-miR-4649-3p	CLIP-seq
MIRT1480268	hsa-miR-4722-5p	CLIP-seq
MIRT2364813	hsa-miR-4723-5p	CLIP-seq
MIRT2364814	hsa-miR-4743	CLIP-seq
MIRT2364815	hsa-miR-4749-3p	CLIP-seq
MIRT1480270	hsa-miR-4779	CLIP-seq
MIRT2364816	hsa-miR-548u	CLIP-seq
MIRT2364817	hsa-miR-662	CLIP-seq
MIRT1480274	hsa-miR-940	CLIP-seq
MIRT2658655	hsa-miR-125a-3p	CLIP-seq
MIRT1480259	hsa-miR-1470	CLIP-seq
MIRT1480261	hsa-miR-1827	CLIP-seq
MIRT2658656	hsa-miR-3612	CLIP-seq
MIRT1480264	hsa-miR-3616-3p	CLIP-seq
MIRT1480265	hsa-miR-4446-5p	CLIP-seq
MIRT1480266	hsa-miR-4459	CLIP-seq
MIRT2658657	hsa-miR-4470	CLIP-seq
MIRT1480267	hsa-miR-4667-3p	CLIP-seq
MIRT2658658	hsa-miR-4688	CLIP-seq
MIRT2658659	hsa-miR-4716-3p	CLIP-seq
MIRT1480268	hsa-miR-4722-5p	CLIP-seq
MIRT2364813	hsa-miR-4723-5p	CLIP-seq
MIRT2658660	hsa-miR-4728-5p	CLIP-seq
MIRT1480269	hsa-miR-4755-5p	CLIP-seq
MIRT1480270	hsa-miR-4779	CLIP-seq
MIRT1480271	hsa-miR-4787-5p	CLIP-seq
MIRT2658661	hsa-miR-552	CLIP-seq
MIRT1480272	hsa-miR-615-5p	CLIP-seq
MIRT1480273	hsa-miR-642a	CLIP-seq
MIRT2658662	hsa-miR-650	CLIP-seq
MIRT1480274	hsa-miR-940	CLIP-seq
MIRT2658655	hsa-miR-125a-3p	CLIP-seq
MIRT1480259	hsa-miR-1470	CLIP-seq
MIRT1480261	hsa-miR-1827	CLIP-seq
MIRT2658656	hsa-miR-3612	CLIP-seq
MIRT1480264	hsa-miR-3616-3p	CLIP-seq
MIRT1480265	hsa-miR-4446-5p	CLIP-seq
MIRT1480266	hsa-miR-4459	CLIP-seq
MIRT2658657	hsa-miR-4470	CLIP-seq
MIRT1480267	hsa-miR-4667-3p	CLIP-seq
MIRT2658658	hsa-miR-4688	CLIP-seq
MIRT2658659	hsa-miR-4716-3p	CLIP-seq
MIRT1480268	hsa-miR-4722-5p	CLIP-seq
MIRT2364813	hsa-miR-4723-5p	CLIP-seq
MIRT2658660	hsa-miR-4728-5p	CLIP-seq
MIRT1480269	hsa-miR-4755-5p	CLIP-seq
MIRT1480270	hsa-miR-4779	CLIP-seq
MIRT1480271	hsa-miR-4787-5p	CLIP-seq
MIRT2658661	hsa-miR-552	CLIP-seq
MIRT1480272	hsa-miR-615-5p	CLIP-seq
MIRT1480273	hsa-miR-642a	CLIP-seq
MIRT2658662	hsa-miR-650	CLIP-seq
MIRT1480274	hsa-miR-940	CLIP-seq

42 Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	38377992
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	37208329
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	7578059
GO:0004843	Function	Cysteine-type deubiquitinase activity	EXP	26235645
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	24424410
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 16712842, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	37208329
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	TAS	9827704
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	37534934
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	19098288
GO:0043130	Function	Ubiquitin binding	IDA	24424410
GO:0043130	Function	Ubiquitin binding	IEA
GO:0045727	Process	Positive regulation of translation	IMP	28106072
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0046872	Function	Metal ion binding	IEA
GO:0050868	Process	Negative regulation of T cell activation	IDA	38377992
GO:0071108	Process	Protein K48-linked deubiquitination	IMP	19098288
GO:0098793	Component	Presynapse	IEA
GO:0101005	Function	Deubiquitinase activity	IDA	26917723, 37534934, 39761299
GO:0140251	Process	Regulation protein catabolic process at presynapse	IEA
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	24424410, 39032648

MIM	HGNC	e!Ensembl
601447	12628	ENSG00000111667

P45974

Protein name

Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.4.19.12) (Deubiquitinating enzyme 5) (Isopeptidase T) (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5)

Protein function

Deubiquitinating enzyme that participates in a wide range of cellular processes by specifically cleaving isopeptide bonds between ubiquitin and substrate proteins or ubiquitin itself. Affects thereby important cellular signaling pathways such as

PDB

2DAG , 2DAK , 2G43 , 2G45 , 3IHP , 6DXH , 6DXT , 6NFT , 6P9G , 7MS5 , 7MS6 , 7MS7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	326 → 853	Ubiquitin carboxyl-terminal hydrolase	Family
PF00627	UBA	723 → 759	UBA/TS-N domain	Domain
PF00627	UBA	655 → 692	UBA/TS-N domain	Domain
PF02148	zf-UBP	199 → 272	Zn-finger in ubiquitin-hydrolases and other protein	Domain
PF17807	zf-UBP_var	16 → 79	Variant UBP zinc finger	Domain

Sequence

MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS

Sequence length

858

Interactions

View interactions

Reactome Pathway
Ub-specific processing proteases
Synthesis of active ubiquitin: roles of E1 and E2 enzymes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Malignant tumor of esophagus	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (30)
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28807830, 31845546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32214906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20005186, 37642235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21976412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31727867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31727867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31281542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31727867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21976412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21976412, 28807830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21976412, 28807830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28523650, 28807830, 28881591, 30809294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28807830, 29029505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31371702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28807830, 30555744, 30809294, 31452281, 31756387, 31845546		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28807830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28933784, 31452281, 31639138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	28933784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	39664566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30555744, 30809294, 31371702, 31452281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30340616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30555744		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29512757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28807830, 29029505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28807830, 31845546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	40066708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31371702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38217030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34776794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

USP5 (ubiquitin specific peptidase 5)

Bookmark This Gene