ULBP1 (UL16 binding protein 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 80329
• Gene name: UL16 binding protein 1
• Gene symbol: ULBP1
• Synonyms (NCBI Gene): N2DL-1, NKG2DL1, RAET1I
• Chromosome: 6
• Chromosome location: 6q25.1
• Summary: The protein encoded by this gene is a ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of the encoded ligand to NKG2D leads to activation of several signal transduction pathways, inc

miRNA Show/Hide all (178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1474561	hsa-miR-1225-3p	CLIP-seq
MIRT1474562	hsa-miR-1233	CLIP-seq
MIRT1474563	hsa-miR-125a-5p	CLIP-seq
MIRT1474564	hsa-miR-125b	CLIP-seq
MIRT1474565	hsa-miR-1270	CLIP-seq
MIRT1474566	hsa-miR-1290	CLIP-seq
MIRT1474567	hsa-miR-1343	CLIP-seq
MIRT1474568	hsa-miR-139-5p	CLIP-seq
MIRT1474569	hsa-miR-148a	CLIP-seq
MIRT1474570	hsa-miR-148b	CLIP-seq
MIRT1474571	hsa-miR-152	CLIP-seq
MIRT1474572	hsa-miR-2114	CLIP-seq
MIRT1474573	hsa-miR-2117	CLIP-seq
MIRT1474574	hsa-miR-223	CLIP-seq
MIRT1474575	hsa-miR-2355-5p	CLIP-seq
MIRT1474576	hsa-miR-28-5p	CLIP-seq
MIRT1474577	hsa-miR-3125	CLIP-seq
MIRT1474578	hsa-miR-3139	CLIP-seq
MIRT1474579	hsa-miR-3147	CLIP-seq
MIRT1474580	hsa-miR-3168	CLIP-seq
MIRT1474581	hsa-miR-3614-5p	CLIP-seq
MIRT1474582	hsa-miR-3615	CLIP-seq
MIRT1474583	hsa-miR-3663-5p	CLIP-seq
MIRT1474584	hsa-miR-3679-3p	CLIP-seq
MIRT1474585	hsa-miR-3916	CLIP-seq
MIRT1474586	hsa-miR-3929	CLIP-seq
MIRT1474587	hsa-miR-4319	CLIP-seq
MIRT1474588	hsa-miR-432	CLIP-seq
MIRT1474589	hsa-miR-4328	CLIP-seq
MIRT1474590	hsa-miR-4419b	CLIP-seq
MIRT1474591	hsa-miR-4425	CLIP-seq
MIRT1474592	hsa-miR-4434	CLIP-seq
MIRT1474593	hsa-miR-4446-5p	CLIP-seq
MIRT1474594	hsa-miR-4478	CLIP-seq
MIRT1474595	hsa-miR-4487	CLIP-seq
MIRT1474596	hsa-miR-4516	CLIP-seq
MIRT1474597	hsa-miR-452	CLIP-seq
MIRT1474598	hsa-miR-4531	CLIP-seq
MIRT1474599	hsa-miR-4652-3p	CLIP-seq
MIRT1474600	hsa-miR-4661-3p	CLIP-seq
MIRT1474601	hsa-miR-4676-3p	CLIP-seq
MIRT1474602	hsa-miR-4697-3p	CLIP-seq
MIRT1474603	hsa-miR-4711-5p	CLIP-seq
MIRT1474604	hsa-miR-4732-3p	CLIP-seq
MIRT1474605	hsa-miR-4760-5p	CLIP-seq
MIRT1474606	hsa-miR-4768-5p	CLIP-seq
MIRT1474607	hsa-miR-4777-5p	CLIP-seq
MIRT1474608	hsa-miR-4778-3p	CLIP-seq
MIRT1474609	hsa-miR-4790-3p	CLIP-seq
MIRT1474610	hsa-miR-485-5p	CLIP-seq
MIRT1474611	hsa-miR-515-5p	CLIP-seq
MIRT1474612	hsa-miR-518d-5p	CLIP-seq
MIRT1474613	hsa-miR-519b-5p	CLIP-seq
MIRT1474614	hsa-miR-519c-5p	CLIP-seq
MIRT1474615	hsa-miR-520c-5p	CLIP-seq
MIRT1474616	hsa-miR-526a	CLIP-seq
MIRT1474617	hsa-miR-539	CLIP-seq
MIRT1474618	hsa-miR-544b	CLIP-seq
MIRT1474619	hsa-miR-548t	CLIP-seq
MIRT1474620	hsa-miR-550a	CLIP-seq
MIRT1474621	hsa-miR-582-5p	CLIP-seq
MIRT1474622	hsa-miR-620	CLIP-seq
MIRT1474623	hsa-miR-627	CLIP-seq
MIRT1474624	hsa-miR-665	CLIP-seq
MIRT1474625	hsa-miR-670	CLIP-seq
MIRT1474626	hsa-miR-708	CLIP-seq
MIRT1474627	hsa-miR-720	CLIP-seq
MIRT1474628	hsa-miR-877	CLIP-seq
MIRT1474629	hsa-miR-924	CLIP-seq
MIRT1474630	hsa-miR-935	CLIP-seq
MIRT1474563	hsa-miR-125a-5p	CLIP-seq
MIRT1474564	hsa-miR-125b	CLIP-seq
MIRT1474587	hsa-miR-4319	CLIP-seq
MIRT1474600	hsa-miR-4661-3p	CLIP-seq
MIRT1474604	hsa-miR-4732-3p	CLIP-seq
MIRT1474618	hsa-miR-544b	CLIP-seq
MIRT1474625	hsa-miR-670	CLIP-seq
MIRT2142830	hsa-miR-1184	CLIP-seq
MIRT2142831	hsa-miR-1205	CLIP-seq
MIRT2142832	hsa-miR-1206	CLIP-seq
MIRT2142833	hsa-miR-1273g	CLIP-seq
MIRT2142834	hsa-miR-197	CLIP-seq
MIRT2142835	hsa-miR-1976	CLIP-seq
MIRT2142836	hsa-miR-298	CLIP-seq
MIRT2142837	hsa-miR-3158-5p	CLIP-seq
MIRT2142838	hsa-miR-3160-5p	CLIP-seq
MIRT2142839	hsa-miR-3180-5p	CLIP-seq
MIRT2142840	hsa-miR-3194-3p	CLIP-seq
MIRT2142841	hsa-miR-3545-3p	CLIP-seq
MIRT2142842	hsa-miR-3607-3p	CLIP-seq
MIRT2142843	hsa-miR-3665	CLIP-seq
MIRT2142844	hsa-miR-3686	CLIP-seq
MIRT2142845	hsa-miR-370	CLIP-seq
MIRT2142846	hsa-miR-3944-5p	CLIP-seq
MIRT2142847	hsa-miR-4252	CLIP-seq
MIRT2142848	hsa-miR-4318	CLIP-seq
MIRT1474599	hsa-miR-4652-3p	CLIP-seq
MIRT2142849	hsa-miR-4659a-3p	CLIP-seq
MIRT2142850	hsa-miR-4659b-3p	CLIP-seq
MIRT2142851	hsa-miR-4680-5p	CLIP-seq
MIRT1474608	hsa-miR-4778-3p	CLIP-seq
MIRT1474610	hsa-miR-485-5p	CLIP-seq
MIRT2142852	hsa-miR-520a-5p	CLIP-seq
MIRT2142853	hsa-miR-525-5p	CLIP-seq
MIRT2142854	hsa-miR-532-5p	CLIP-seq
MIRT2142855	hsa-miR-654-3p	CLIP-seq
MIRT2142856	hsa-miR-657	CLIP-seq
MIRT2363185	hsa-miR-1260	CLIP-seq
MIRT2363186	hsa-miR-1260b	CLIP-seq
MIRT2363187	hsa-miR-1299	CLIP-seq
MIRT2363188	hsa-miR-188-3p	CLIP-seq
MIRT1474572	hsa-miR-2114	CLIP-seq
MIRT2363189	hsa-miR-219-2-3p	CLIP-seq
MIRT2363190	hsa-miR-2964a-3p	CLIP-seq
MIRT2363191	hsa-miR-3156-3p	CLIP-seq
MIRT2363192	hsa-miR-3674	CLIP-seq
MIRT2363193	hsa-miR-3935	CLIP-seq
MIRT2363194	hsa-miR-4452	CLIP-seq
MIRT1474599	hsa-miR-4652-3p	CLIP-seq
MIRT2363195	hsa-miR-4716-5p	CLIP-seq
MIRT1474607	hsa-miR-4777-5p	CLIP-seq
MIRT2363196	hsa-miR-4782-5p	CLIP-seq
MIRT2363197	hsa-miR-502-5p	CLIP-seq
MIRT2363198	hsa-miR-516b	CLIP-seq
MIRT1474612	hsa-miR-518d-5p	CLIP-seq
MIRT1474613	hsa-miR-519b-5p	CLIP-seq
MIRT1474614	hsa-miR-519c-5p	CLIP-seq
MIRT1474615	hsa-miR-520c-5p	CLIP-seq
MIRT1474616	hsa-miR-526a	CLIP-seq
MIRT2363199	hsa-miR-568	CLIP-seq
MIRT2363200	hsa-miR-628-5p	CLIP-seq
MIRT2363201	hsa-miR-944	CLIP-seq
MIRT1474572	hsa-miR-2114	CLIP-seq
MIRT2396666	hsa-miR-3622b-5p	CLIP-seq
MIRT2396667	hsa-miR-455-5p	CLIP-seq
MIRT1474607	hsa-miR-4777-5p	CLIP-seq
MIRT1474612	hsa-miR-518d-5p	CLIP-seq
MIRT1474613	hsa-miR-519b-5p	CLIP-seq
MIRT1474614	hsa-miR-519c-5p	CLIP-seq
MIRT1474615	hsa-miR-520c-5p	CLIP-seq
MIRT1474616	hsa-miR-526a	CLIP-seq
MIRT1474620	hsa-miR-550a	CLIP-seq
MIRT2142847	hsa-miR-4252	CLIP-seq
MIRT2441603	hsa-miR-4747-5p	CLIP-seq
MIRT2142833	hsa-miR-1273g	CLIP-seq
MIRT2657109	hsa-miR-2116	CLIP-seq
MIRT2657110	hsa-miR-299-3p	CLIP-seq
MIRT2657111	hsa-miR-324-5p	CLIP-seq
MIRT2657112	hsa-miR-33a	CLIP-seq
MIRT2657113	hsa-miR-33b	CLIP-seq
MIRT2142842	hsa-miR-3607-3p	CLIP-seq
MIRT2142844	hsa-miR-3686	CLIP-seq
MIRT2657114	hsa-miR-3689a-3p	CLIP-seq
MIRT2657115	hsa-miR-3689c	CLIP-seq
MIRT2142847	hsa-miR-4252	CLIP-seq
MIRT2657116	hsa-miR-4491	CLIP-seq
MIRT1474599	hsa-miR-4652-3p	CLIP-seq
MIRT2657117	hsa-miR-4657	CLIP-seq
MIRT2657118	hsa-miR-4677-5p	CLIP-seq
MIRT2657119	hsa-miR-4728-5p	CLIP-seq
MIRT2441603	hsa-miR-4747-5p	CLIP-seq
MIRT2657120	hsa-miR-651	CLIP-seq
MIRT2142855	hsa-miR-654-3p	CLIP-seq
MIRT2142833	hsa-miR-1273g	CLIP-seq
MIRT2657109	hsa-miR-2116	CLIP-seq
MIRT2657110	hsa-miR-299-3p	CLIP-seq
MIRT2142842	hsa-miR-3607-3p	CLIP-seq
MIRT2142844	hsa-miR-3686	CLIP-seq
MIRT2657114	hsa-miR-3689a-3p	CLIP-seq
MIRT2657115	hsa-miR-3689c	CLIP-seq
MIRT2142847	hsa-miR-4252	CLIP-seq
MIRT2657116	hsa-miR-4491	CLIP-seq
MIRT1474599	hsa-miR-4652-3p	CLIP-seq
MIRT2657117	hsa-miR-4657	CLIP-seq
MIRT2657118	hsa-miR-4677-5p	CLIP-seq
MIRT2657119	hsa-miR-4728-5p	CLIP-seq
MIRT2441603	hsa-miR-4747-5p	CLIP-seq
MIRT2142855	hsa-miR-654-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC3	Unknown	19430493

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0005515	Function	Protein binding	IPI	28559451
GO:0005615	Component	Extracellular space	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	11239445
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030101	Process	Natural killer cell activation	IDA	11239445
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	17562706
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	11239445
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IDA	11239445
GO:0048018	Function	Receptor ligand activity	IDA	15051759
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 605697
• HGNC: 14893
• e!Ensembl: ENSG00000111981

Protein

• UniProt ID: Q9BZM6
• Protein name: UL16-binding protein 1 (ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)
• Protein function: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00129	MHC_I	29 → 205	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in T-cells, B-cells, erythroleukemia cell lines and in a wide range of tissues including heart, brain, lung, liver, testis, lymph node, thymus, tonsil and bone marrow. Also found in fetal heart, brain, lung and liver.
• Sequence:

  MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERP
  FLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLT
  LQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTM
  FFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFI
  LAGR

• Sequence length: 244

Pathways

KEGG Pathway:

Natural killer cell mediated cytotoxicity

Reactome Pathway:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (40)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24677544		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	31827723		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	19798433	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21499124		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26608587	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33909599	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21951556	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28684217	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28684217		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31451090	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31451090		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31451090		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27116977	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	19013003	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29693186	Inhibit	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	37565867	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20101024, 23445485	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20101024		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	22304689	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15657183, 17993609, 24677544, 28404876, 29449224	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15657183, 24677544		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21756848, 29511613		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29511613		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	20101024		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20101024	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21499124		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29391893		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18463537		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	23298273		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	37298418	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20101024, 28383557		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31827723		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29910819		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23297870	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19414815	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19414815		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29391893		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32077634	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26113176		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25510288	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HCST 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. SH2D1B 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. RAET1E 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. NCR3 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. SH2D1A 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HCST	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
SH2D1B	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
RAET1E	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
NCR3	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
SH2D1A	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]

Diseases Linked via Similar Genes

Autism Linked via 1 of 5 related genesRAET1E Asthma Linked via 1 of 5 related genesNCR3 Atrial fibrillation Linked via 1 of 5 related genesNCR3 Autoimmune thyroid disease Linked via 1 of 5 related genesNCR3 Coronary artery disease Linked via 1 of 5 related genesNCR3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Autism	1	["RAET1E"]
Asthma	1	["NCR3"]
Atrial fibrillation	1	["NCR3"]
Autoimmune thyroid disease	1	["NCR3"]
Coronary artery disease	1	["NCR3"]