Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10870
Gene name	Hematopoietic cell signal transducer
Gene symbol	HCST
Synonyms (NCBI Gene)	DAP10KAP10PIK3AP
Chromosome	19
Chromosome location	19q13.12
Summary	This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor com

miRTarBase ID	miRNA	Experiments	Reference
MIRT018108	hsa-miR-335-5p	Microarray	18185580
MIRT755477	hsa-miR-186-5p	Luciferase reporter assayWestern blottingqRT-PCR	36499501

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	15294961
GO:0005515	Function	Protein binding	IPI	10426994, 26221034, 32296183, 32814053
GO:0005886	Component	Plasma membrane	IDA	15894612
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	IGI	10528161
GO:0009986	Component	Cell surface	IDA	10426994, 15294961
GO:0016020	Component	Membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	16582911
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	16582911
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	16582911
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IBA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IDA	10426994
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0050776	Process	Regulation of immune response	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	10426994
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA

MIM	HGNC	e!Ensembl
604089	16977	ENSG00000126264

Q9UBK5

Protein name

Hematopoietic cell signal transducer (DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10)

Protein function

Transmembrane adapter protein which associates with KLRK1 to form an activation receptor KLRK1-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands s

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07213	DAP10	27 → 93	DAP10 membrane protein	Family
PF07213	DAP10	1 → 33	DAP10 membrane protein	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in hemopoietic cells such as NK cells, subset of T-cells and monocytes. Detected in leukocytes, spleen, and thymus. {ECO:0000269|PubMed:10528161}.

Sequence

MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVA
SLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG

Sequence length

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Natural killer cell mediated cytotoxicity	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

HCST (hematopoietic cell signal transducer)

Bookmark This Gene