RAET1E (retinoic acid early transcript 1E)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 135250
• Gene name: Retinoic acid early transcript 1E
• Gene symbol: RAET1E
• Synonyms (NCBI Gene): LETAL, N2DL-4, NKG2DL4, RAET1E2, RL-4, ULBP4, bA350J20.7
• Chromosome: 6
• Chromosome location: 6q25.1
• Summary: This gene belong to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. This and RAET1G protein differ from other RAET1 proteins in that they have type I membran

miRNA Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022530	hsa-miR-124-3p	Microarray	18668037
MIRT669882	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT669881	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT669880	hsa-miR-5690	HITS-CLIP	23824327
MIRT669879	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT669878	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT669877	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT669876	hsa-miR-4284	HITS-CLIP	23824327
MIRT669875	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT669874	hsa-miR-1268a	HITS-CLIP	23824327
MIRT669873	hsa-miR-1268b	HITS-CLIP	23824327
MIRT669872	hsa-miR-7977	HITS-CLIP	23824327
MIRT669871	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT669870	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT634914	hsa-miR-8485	HITS-CLIP	23824327
MIRT634910	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT634909	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT634908	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT634907	hsa-miR-507	HITS-CLIP	23824327
MIRT634906	hsa-miR-557	HITS-CLIP	23824327
MIRT634905	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT634904	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT634913	hsa-miR-6733-3p	HITS-CLIP	23824327
MIRT634912	hsa-miR-4302	HITS-CLIP	23824327
MIRT634911	hsa-miR-4276	HITS-CLIP	23824327
MIRT634910	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT634909	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT634908	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT634907	hsa-miR-507	HITS-CLIP	23824327
MIRT634906	hsa-miR-557	HITS-CLIP	23824327
MIRT634905	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT634904	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT634914	hsa-miR-8485	HITS-CLIP	23824327
MIRT634913	hsa-miR-6733-3p	HITS-CLIP	23824327
MIRT634912	hsa-miR-4302	HITS-CLIP	23824327
MIRT634911	hsa-miR-4276	HITS-CLIP	23824327
MIRT634910	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT634909	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT634908	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT634907	hsa-miR-507	HITS-CLIP	23824327
MIRT634906	hsa-miR-557	HITS-CLIP	23824327
MIRT634905	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT634904	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT669882	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT669881	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT669880	hsa-miR-5690	HITS-CLIP	23824327
MIRT669879	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT669878	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT669877	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT669876	hsa-miR-4284	HITS-CLIP	23824327
MIRT669875	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT669874	hsa-miR-1268a	HITS-CLIP	23824327
MIRT669873	hsa-miR-1268b	HITS-CLIP	23824327
MIRT669872	hsa-miR-7977	HITS-CLIP	23824327
MIRT669871	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT669870	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT634914	hsa-miR-8485	HITS-CLIP	23824327
MIRT634910	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT634909	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT634908	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT634907	hsa-miR-507	HITS-CLIP	23824327
MIRT634906	hsa-miR-557	HITS-CLIP	23824327
MIRT634905	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT634904	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT634913	hsa-miR-6733-3p	HITS-CLIP	23824327
MIRT634912	hsa-miR-4302	HITS-CLIP	23824327
MIRT634911	hsa-miR-4276	HITS-CLIP	23824327
MIRT634910	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT634909	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT634908	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT634907	hsa-miR-507	HITS-CLIP	23824327
MIRT634906	hsa-miR-557	HITS-CLIP	23824327
MIRT634905	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT634904	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT634914	hsa-miR-8485	HITS-CLIP	23824327
MIRT634913	hsa-miR-6733-3p	HITS-CLIP	23824327
MIRT634912	hsa-miR-4302	HITS-CLIP	23824327
MIRT634911	hsa-miR-4276	HITS-CLIP	23824327
MIRT634910	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT634909	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT634908	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT634907	hsa-miR-507	HITS-CLIP	23824327
MIRT634906	hsa-miR-557	HITS-CLIP	23824327
MIRT634905	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT634904	hsa-miR-129-5p	HITS-CLIP	23824327

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0005515	Function	Protein binding	IPI	18544572, 19436053, 19658097, 28559451
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	NAS	15240696
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	15240696
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IDA	18544572
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IEA
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IPI	15240696

Other IDs

• MIM: 609243
• HGNC: 16793
• e!Ensembl: ENSG00000164520

Protein

• UniProt ID: Q8TD07
• Protein name: Retinoic acid early transcript 1E (Lymphocyte effector toxicity activation ligand) (NKG2D ligand 4) (N2DL-4) (NKG2DL4) (RAE-1-like transcript 4) (UL16-binding protein 4)
• Protein function: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00129	MHC_I	29 → 202	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in the skin, but also expressed in testis and trachea. Up-regulated in tumor cells of different origins. Expression progressively decreased after treatment of tumor cells with retinoic acid. {ECO:0000269|PubMed:
• Sequence:

  MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNL
  FLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTL
  QVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKY
  FRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMG
  IVLICVWWQNGEWQAGLWPLRTS

• Sequence length: 263

Pathways

KEGG Pathway:

Natural killer cell mediated cytotoxicity

Reactome Pathway:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35215271	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (16)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31827723		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30662365	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22257486, 25803781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36353638	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35936986	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19436053		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30662365	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28684217	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30662365	Associate	★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	30662365	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34873031	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28159927	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28159927		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17470428, 19436053		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23297870	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25510288	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HCST 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. SH2D1B 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. NCR3 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. SH2D1A 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell. ULBP3 2 shared pathwaysNatural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Related via 2 shared pathways including Natural killer cell mediated cytotoxicity, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HCST	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
SH2D1B	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
NCR3	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
SH2D1A	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]
ULBP3	0	[]	2	["Natural killer cell mediated cytotoxicity","Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell"]	0	[]

Diseases Linked via Similar Genes

Non-melanoma skin carcinoma Linked via 2 of 5 related genesNCR3, ULBP3 Asthma Linked via 1 of 5 related genesNCR3 Atrial fibrillation Linked via 1 of 5 related genesNCR3 Autoimmune thyroid disease Linked via 1 of 5 related genesNCR3 Coronary artery disease Linked via 1 of 5 related genesNCR3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Non-melanoma skin carcinoma	2	["NCR3","ULBP3"]
Asthma	1	["NCR3"]
Atrial fibrillation	1	["NCR3"]
Autoimmune thyroid disease	1	["NCR3"]
Coronary artery disease	1	["NCR3"]