Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	7295
Gene name	Thioredoxin
Gene symbol	TXN
Synonyms (NCBI Gene)	TRDXTRXTRX1TXN1Trx80
Chromosome	9
Chromosome location	9q31.3
Summary	The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. Th

52 Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046747	hsa-miR-222-3p	CLASH	23622248
MIRT045602	hsa-miR-149-5p	CLASH	23622248
MIRT035966	hsa-miR-1301-3p	CLASH	23622248
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT441782	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT441781	hsa-miR-6882-5p	PAR-CLIP	22100165
MIRT441780	hsa-miR-889-5p	PAR-CLIP	22100165
MIRT441779	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464896	hsa-miR-409-3p	CLIP-seq
MIRT1464897	hsa-miR-4307	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464896	hsa-miR-409-3p	CLIP-seq
MIRT1464897	hsa-miR-4307	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464896	hsa-miR-409-3p	CLIP-seq
MIRT1464897	hsa-miR-4307	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT2653928	hsa-miR-3652	CLIP-seq
MIRT2653929	hsa-miR-3942-3p	CLIP-seq
MIRT2653930	hsa-miR-4430	CLIP-seq
MIRT2653931	hsa-miR-4505	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq
MIRT1464895	hsa-miR-1279	CLIP-seq
MIRT2653928	hsa-miR-3652	CLIP-seq
MIRT2653930	hsa-miR-4430	CLIP-seq
MIRT2653931	hsa-miR-4505	CLIP-seq
MIRT1464898	hsa-miR-629	CLIP-seq
MIRT1464899	hsa-miR-654-3p	CLIP-seq

Transcription factor	Regulation	Reference
HSF2	Unknown	9374530
JUN	Unknown	12414792
PPARD	Activation	18048767

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0004791	Function	Thioredoxin-disulfide reductase (NADPH) activity	TAS
GO:0005515	Function	Protein binding	IPI	9108029, 10814541, 11118054, 15246877, 15480426, 15657067, 17260951, 17557078, 17606900, 19690162, 19805025, 20029029, 21145461, 21771788, 21988832, 24658140, 24976139, 25402766, 28514442, 31980649, 32296183, 32814053
GO:0005576	Component	Extracellular region	IDA	1332947
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	9108029
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	9108029
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0009314	Process	Response to radiation	IDA	9108029, 11118054
GO:0015035	Function	Protein-disulfide reductase activity	IDA	2176490, 17182577, 19032234
GO:0015035	Function	Protein-disulfide reductase activity	IEA
GO:0019725	Process	Cellular homeostasis	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	9369469, 17260951
GO:0043388	Process	Positive regulation of DNA binding	IDA	11118054
GO:0045454	Process	Cell redox homeostasis	IDA	2176490
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	IMP	9108029
GO:0046826	Process	Negative regulation of protein export from nucleus	IEA
GO:0047134	Function	Protein-disulfide reductase [NAD(P)H] activity	IDA	17182577
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	22492997
GO:0061692	Process	Cellular detoxification of hydrogen peroxide	IGI	22492997
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071731	Process	Response to nitric oxide	IMP	16408020, 17606900

MIM	HGNC	e!Ensembl
187700	12435	ENSG00000136810

P10599

Protein name

Thioredoxin (Trx) (ATL-derived factor) (ADF) (Surface-associated sulphydryl protein) (SASP) (allergen Hom s Trx)

Protein function

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (PubMed:17182577, PubMed:19032234, PubMed:2176490). Plays a role in the rever

PDB

1AIU , 1AUC , 1CQG , 1CQH , 1ERT , 1ERU , 1ERV , 1ERW , 1M7T , 1MDI , 1MDJ , 1MDK , 1TRS , 1TRU , 1TRV , 1TRW , 2HSH , 2HXK , 2IFQ , 2IIY , 3E3E , 3KD0 , 3M9J , 3M9K , 3QFA , 3QFB , 3TRX , 4LL1 , 4LL4 , 4OO4 , 4OO5 , 4POK , 4POL , 4POM , 4PUF , 4TRX , 5DQY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00085	Thioredoxin	2 → 103	Thioredoxin	Domain

Sequence

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Sequence length

105

Interactions

View interactions

KEGG Pathway	Reactome Pathway
NOD-like receptor signaling pathway	Oxidative Stress Induced Senescence
Parkinson disease	Detoxification of Reactive Oxygen Species
Salmonella infection	Interconversion of nucleotide di- and triphosphates
Fluid shear stress and atherosclerosis	TP53 Regulates Metabolic Genes
	Protein repair
	The NLRP3 inflammasome
	Purinergic signaling in leishmaniasis infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (14)
BREAST NEOPLASMS	—	CTD	30396169	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	CTD, Disgenet CTD, Disgenet	20812253	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABNORMALITIES	—	CTD	31310794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABNORMALITY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	25724174	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROCEPHALUS	—	CTD, Disgenet CTD, Disgenet	31310794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	27770636	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	16996028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	27032653	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TXN (thioredoxin)

Save This Analysis