Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1843
Gene name	Dual specificity phosphatase 1
Gene symbol	DUSP1
Synonyms (NCBI Gene)	CL100HVH1MKP-1MKP1PTPN10
Chromosome	5
Chromosome location	5q35.1
Summary	The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play

380 Show/Hide all (380)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005876	hsa-miR-101-3p	Luciferase reporter assayqRT-PCRWestern blot	21068409
MIRT005876	hsa-miR-101-3p	Luciferase reporter assayqRT-PCRWestern blot	21068409
MIRT028795	hsa-miR-26b-5p	Microarray	19088304
MIRT053465	hsa-miR-200c-3p	Microarray	23807165
MIRT438558	hsa-miR-146a-5p	qRT-PCRWestern blot	23825193
MIRT437985	hsa-miR-940	qRT-PCRMicroarrayWestern blot	24675421
MIRT438558	hsa-miR-146a-5p	qRT-PCRWestern blot	23825193
MIRT437985	hsa-miR-940	qRT-PCRMicroarrayWestern blot	24675421
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT548539	hsa-miR-4500	PAR-CLIP	21572407
MIRT548538	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548537	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548536	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548535	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548534	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548533	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548532	hsa-miR-4458	PAR-CLIP	21572407
MIRT548531	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548530	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548529	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548528	hsa-miR-4678	PAR-CLIP	21572407
MIRT548527	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT548526	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548525	hsa-miR-182-3p	PAR-CLIP	21572407
MIRT548524	hsa-miR-597-3p	PAR-CLIP	21572407
MIRT548523	hsa-miR-152-5p	PAR-CLIP	21572407
MIRT548522	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548521	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT548520	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT548519	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT548518	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT053465	hsa-miR-200c-3p	Luciferase reporter assayqRT-PCRWestern blot	27696308
MIRT733967	hsa-miR-1468-3p	Flow cytometryLuciferase reporter assayRNA-seqqRT-PCRWestern blotting	32348937
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT616893	hsa-miR-192-3p	HITS-CLIP	23824327
MIRT616892	hsa-miR-4776-3p	HITS-CLIP	23824327
MIRT095977	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT548539	hsa-miR-4500	PAR-CLIP	21572407
MIRT548538	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT548537	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT548536	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT548535	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT548534	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT548533	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT548532	hsa-miR-4458	PAR-CLIP	21572407
MIRT548531	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT548530	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT548529	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT548528	hsa-miR-4678	PAR-CLIP	21572407
MIRT548527	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT548526	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT548525	hsa-miR-182-3p	PAR-CLIP	21572407
MIRT548524	hsa-miR-597-3p	PAR-CLIP	21572407
MIRT548523	hsa-miR-152-5p	PAR-CLIP	21572407
MIRT548522	hsa-miR-22-5p	PAR-CLIP	21572407
MIRT548521	hsa-miR-218-1-3p	PAR-CLIP	21572407
MIRT548520	hsa-miR-4659a-3p	PAR-CLIP	21572407
MIRT548519	hsa-miR-4659b-3p	PAR-CLIP	21572407
MIRT548518	hsa-miR-659-3p	PAR-CLIP	21572407
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947381	hsa-miR-1289	CLIP-seq
MIRT947382	hsa-miR-137	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947388	hsa-miR-203	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947390	hsa-miR-25	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947392	hsa-miR-3183	CLIP-seq
MIRT947393	hsa-miR-3198	CLIP-seq
MIRT947394	hsa-miR-32	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT947396	hsa-miR-33a	CLIP-seq
MIRT947397	hsa-miR-33b	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947399	hsa-miR-363	CLIP-seq
MIRT947400	hsa-miR-367	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT947407	hsa-miR-4279	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT947409	hsa-miR-4294	CLIP-seq
MIRT947410	hsa-miR-4309	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT947414	hsa-miR-4709-3p	CLIP-seq
MIRT947415	hsa-miR-4723-3p	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT947417	hsa-miR-513a-3p	CLIP-seq
MIRT947418	hsa-miR-513c	CLIP-seq
MIRT947419	hsa-miR-514b-5p	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947422	hsa-miR-92a	CLIP-seq
MIRT947423	hsa-miR-92b	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT1548066	hsa-miR-3163	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT1548075	hsa-miR-568	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT2215663	hsa-miR-1225-3p	CLIP-seq
MIRT2215664	hsa-miR-1245b-3p	CLIP-seq
MIRT2215665	hsa-miR-133a	CLIP-seq
MIRT2215666	hsa-miR-133b	CLIP-seq
MIRT2215667	hsa-miR-141	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT2215668	hsa-miR-182	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT2215669	hsa-miR-200a	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2215670	hsa-miR-3171	CLIP-seq
MIRT2215671	hsa-miR-3189-5p	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT2215672	hsa-miR-4281	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT2215673	hsa-miR-4301	CLIP-seq
MIRT2215674	hsa-miR-431	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq
MIRT2215676	hsa-miR-4698	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT947414	hsa-miR-4709-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2215677	hsa-miR-4749-3p	CLIP-seq
MIRT2215678	hsa-miR-4774-5p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT2215679	hsa-miR-516a-5p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT2215680	hsa-miR-548ac	CLIP-seq
MIRT2215681	hsa-miR-548ag	CLIP-seq
MIRT2215682	hsa-miR-548ai	CLIP-seq
MIRT2215683	hsa-miR-548d-3p	CLIP-seq
MIRT2215684	hsa-miR-548z	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT2215685	hsa-miR-603	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947372	hsa-let-7a	CLIP-seq
MIRT947373	hsa-let-7b	CLIP-seq
MIRT947374	hsa-let-7c	CLIP-seq
MIRT947375	hsa-let-7d	CLIP-seq
MIRT947376	hsa-let-7e	CLIP-seq
MIRT947377	hsa-let-7f	CLIP-seq
MIRT947378	hsa-let-7g	CLIP-seq
MIRT947379	hsa-let-7i	CLIP-seq
MIRT947380	hsa-miR-101	CLIP-seq
MIRT2215667	hsa-miR-141	CLIP-seq
MIRT947383	hsa-miR-144	CLIP-seq
MIRT1548062	hsa-miR-148a	CLIP-seq
MIRT1548063	hsa-miR-148b	CLIP-seq
MIRT1548064	hsa-miR-152	CLIP-seq
MIRT2215668	hsa-miR-182	CLIP-seq
MIRT1548065	hsa-miR-194	CLIP-seq
MIRT2215669	hsa-miR-200a	CLIP-seq
MIRT947385	hsa-miR-200b	CLIP-seq
MIRT947386	hsa-miR-200c	CLIP-seq
MIRT947387	hsa-miR-202	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1548066	hsa-miR-3163	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2428403	hsa-miR-3185	CLIP-seq
MIRT947395	hsa-miR-331-5p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT947398	hsa-miR-3613-3p	CLIP-seq
MIRT947401	hsa-miR-369-3p	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT947402	hsa-miR-371b-5p	CLIP-seq
MIRT1548067	hsa-miR-380	CLIP-seq
MIRT947404	hsa-miR-3924	CLIP-seq
MIRT947406	hsa-miR-411	CLIP-seq
MIRT947408	hsa-miR-429	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT1548068	hsa-miR-4495	CLIP-seq
MIRT1548069	hsa-miR-4662a-3p	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215676	hsa-miR-4698	CLIP-seq
MIRT947412	hsa-miR-4699-3p	CLIP-seq
MIRT947413	hsa-miR-4700-3p	CLIP-seq
MIRT1548070	hsa-miR-4720-3p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2215678	hsa-miR-4774-5p	CLIP-seq
MIRT2428404	hsa-miR-4778-3p	CLIP-seq
MIRT1548071	hsa-miR-4793-5p	CLIP-seq
MIRT1980638	hsa-miR-4795-3p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1548072	hsa-miR-4804-3p	CLIP-seq
MIRT1548073	hsa-miR-495	CLIP-seq
MIRT947416	hsa-miR-5095	CLIP-seq
MIRT1548074	hsa-miR-512-3p	CLIP-seq
MIRT947417	hsa-miR-513a-3p	CLIP-seq
MIRT1980640	hsa-miR-545	CLIP-seq
MIRT2215680	hsa-miR-548ac	CLIP-seq
MIRT2215681	hsa-miR-548ag	CLIP-seq
MIRT2215682	hsa-miR-548ai	CLIP-seq
MIRT2215683	hsa-miR-548d-3p	CLIP-seq
MIRT2215684	hsa-miR-548z	CLIP-seq
MIRT1548075	hsa-miR-568	CLIP-seq
MIRT1548076	hsa-miR-570	CLIP-seq
MIRT1548077	hsa-miR-587	CLIP-seq
MIRT1980641	hsa-miR-656	CLIP-seq
MIRT947420	hsa-miR-659	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT947421	hsa-miR-888	CLIP-seq
MIRT947424	hsa-miR-98	CLIP-seq
MIRT2436894	hsa-miR-1236	CLIP-seq
MIRT2215664	hsa-miR-1245b-3p	CLIP-seq
MIRT2436895	hsa-miR-1913	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT1980633	hsa-miR-3166	CLIP-seq
MIRT2215670	hsa-miR-3171	CLIP-seq
MIRT2436896	hsa-miR-3182	CLIP-seq
MIRT2215671	hsa-miR-3189-5p	CLIP-seq
MIRT2436897	hsa-miR-324-3p	CLIP-seq
MIRT1980634	hsa-miR-3611	CLIP-seq
MIRT1980635	hsa-miR-3714	CLIP-seq
MIRT1980636	hsa-miR-4493	CLIP-seq
MIRT2436898	hsa-miR-4727-5p	CLIP-seq
MIRT1980637	hsa-miR-4731-3p	CLIP-seq
MIRT2436899	hsa-miR-4753-3p	CLIP-seq
MIRT2436900	hsa-miR-4758-3p	CLIP-seq
MIRT2436901	hsa-miR-4768-5p	CLIP-seq
MIRT1980639	hsa-miR-4801	CLIP-seq
MIRT1980642	hsa-miR-758	CLIP-seq
MIRT2215663	hsa-miR-1225-3p	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq
MIRT2215677	hsa-miR-4749-3p	CLIP-seq
MIRT2215679	hsa-miR-516a-5p	CLIP-seq
MIRT947384	hsa-miR-1912	CLIP-seq
MIRT947389	hsa-miR-224	CLIP-seq
MIRT947391	hsa-miR-3125	CLIP-seq
MIRT947403	hsa-miR-3916	CLIP-seq
MIRT947405	hsa-miR-3928	CLIP-seq
MIRT947411	hsa-miR-4670-3p	CLIP-seq
MIRT2215675	hsa-miR-4687-5p	CLIP-seq

7 Show/Hide all (7)

Transcription factor	Regulation	Reference
ATF2	Unknown	17681939
ATM	Activation	17178844
CREM	Repression	21325296
E2F1	Activation	17638884
PGR	Activation	22020934
STAT6	Unknown	18342537
TP53	Activation	12890671;15611668

51 Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001706	Process	Endoderm formation	IBA
GO:0004721	Function	Phosphoprotein phosphatase activity	IBA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	ISS
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	1406996
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	10617468, 16286470, 20347885, 20936779, 25241761, 27880917
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	7593328
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	7593328
GO:0007162	Process	Negative regulation of cell adhesion	IMP	22991462
GO:0007165	Process	Signal transduction	IBA
GO:0008138	Function	Protein tyrosine/serine/threonine phosphatase activity	IDA	17498703
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009416	Process	Response to light stimulus	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA
GO:0017017	Function	MAP kinase tyrosine/serine/threonine phosphatase activity	ISS
GO:0019838	Function	Growth factor binding	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IDA	1406996
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035970	Process	Peptidyl-threonine dephosphorylation	ISS
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043407	Process	Negative regulation of MAP kinase activity	IDA	7593328
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IEA
GO:0051019	Function	Mitogen-activated protein kinase binding	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051447	Process	Negative regulation of meiotic cell cycle	ISS
GO:0051591	Process	Response to cAMP	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0070262	Process	Peptidyl-serine dephosphorylation	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16314496
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0090027	Process	Negative regulation of monocyte chemotaxis	IMP	22991462
GO:0090266	Process	Regulation of mitotic cell cycle spindle assembly checkpoint	ISS
GO:1903753	Process	Negative regulation of p38MAPK cascade	IBA
GO:1903753	Process	Negative regulation of p38MAPK cascade	IMP	22991462
GO:1990869	Process	Cellular response to chemokine	IMP	22991462
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
600714	3064	ENSG00000120129

P28562

Protein name

Dual specificity protein phosphatase 1 (EC 3.1.3.16) (EC 3.1.3.48) (Dual specificity protein phosphatase hVH1) (Mitogen-activated protein kinase phosphatase 1) (MAP kinase phosphatase 1) (MKP-1) (Protein-tyrosine phosphatase CL100)

Protein function

Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.

PDB

6APX , 6D65 , 6D66 , 6D67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00581	Rhodanese	9 → 131	Rhodanese-like domain	Domain
PF00782	DSPc	181 → 311	Dual specificity phosphatase, catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney. {ECO:0000269|PubMed:8106404}.

Sequence

MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC

Sequence length

367

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	RAF-independent MAPK1/3 activation
Serotonergic synapse	Negative regulation of MAPK pathway
Parkinson disease
Fluid shear stress and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (16)
ARTHRITIS, JUVENILE	—	CTD	19565504	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	37794016	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARRETT'S ESOPHAGUS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	25724174	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	21063030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	16214533	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, SPINE	—	CTD, Disgenet CTD, Disgenet	34697729	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DUSP2	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	3	["MAPK signaling pathway","RAF-independent MAPK1\/3 activation","Negative regulation of MAPK pathway"]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
DUSP4	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	3	["MAPK signaling pathway","RAF-independent MAPK1\/3 activation","Negative regulation of MAPK pathway"]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
OSM	4	["Juvenile arthritis","Contact dermatitis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	5	["CTD (Juvenile arthritis)","Disgenet (Contact dermatitis)","CTD (Contact dermatitis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACP3	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]
ACRBP	3	["Juvenile arthritis","Juvenile idiopathic arthritis","Oligoarticular juvenile idiopathic arthritis"]	0	[]	3	["CTD (Juvenile arthritis)","Disgenet (Juvenile idiopathic arthritis)","Disgenet (Oligoarticular juvenile idiopathic arthritis)"]

DUSP1 (dual specificity phosphatase 1)

Save This Analysis