Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	7133
Gene name	TNF receptor superfamily member 1B
Gene symbol	TNFRSF1B
Synonyms (NCBI Gene)	CD120bTBPIITNF-R-IITNF-R75TNFBRTNFR1BTNFR2TNFR80p75p75TNFR
Chromosome	1
Chromosome location	1p36.22
Summary	The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity.

283

Show/Hide all (283)

miRTarBase ID	miRNA	Experiments	Reference
MIRT717194	hsa-miR-96-3p	HITS-CLIP	19536157
MIRT717193	hsa-miR-299-3p	HITS-CLIP	19536157
MIRT717192	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT717191	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717190	hsa-miR-6072	HITS-CLIP	19536157
MIRT717189	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT717188	hsa-miR-3909	HITS-CLIP	19536157
MIRT717187	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT439411	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439411	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT129887	hsa-miR-193a-3p	HITS-CLIP	22473208
MIRT129893	hsa-miR-193b-3p	HITS-CLIP	22473208
MIRT129958	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT129959	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT717194	hsa-miR-96-3p	HITS-CLIP	19536157
MIRT717193	hsa-miR-299-3p	HITS-CLIP	19536157
MIRT717192	hsa-miR-3607-5p	HITS-CLIP	19536157
MIRT717191	hsa-miR-6884-3p	HITS-CLIP	19536157
MIRT717190	hsa-miR-6072	HITS-CLIP	19536157
MIRT717189	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT717188	hsa-miR-3909	HITS-CLIP	19536157
MIRT717187	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT1443039	hsa-miR-1224-3p	CLIP-seq
MIRT1443040	hsa-miR-1260	CLIP-seq
MIRT1443041	hsa-miR-1260b	CLIP-seq
MIRT1443042	hsa-miR-1280	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT1443044	hsa-miR-150	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT1443050	hsa-miR-323b-3p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT1443052	hsa-miR-3663-5p	CLIP-seq
MIRT1443053	hsa-miR-3929	CLIP-seq
MIRT1443054	hsa-miR-4419b	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443056	hsa-miR-4435	CLIP-seq
MIRT1443057	hsa-miR-4478	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT1443059	hsa-miR-4532	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT1443062	hsa-miR-4701-5p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT1443064	hsa-miR-4713-5p	CLIP-seq
MIRT1443065	hsa-miR-4716-5p	CLIP-seq
MIRT1443066	hsa-miR-4731-3p	CLIP-seq
MIRT1443067	hsa-miR-4755-3p	CLIP-seq
MIRT1443068	hsa-miR-4772-3p	CLIP-seq
MIRT1443069	hsa-miR-4781-3p	CLIP-seq
MIRT1443070	hsa-miR-4786-3p	CLIP-seq
MIRT1443071	hsa-miR-4801	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT1443073	hsa-miR-532-3p	CLIP-seq
MIRT1443074	hsa-miR-548s	CLIP-seq
MIRT1443075	hsa-miR-588	CLIP-seq
MIRT1443076	hsa-miR-635	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2132600	hsa-miR-103b	CLIP-seq
MIRT2132601	hsa-miR-1178	CLIP-seq
MIRT2132602	hsa-miR-1184	CLIP-seq
MIRT2132603	hsa-miR-1207-3p	CLIP-seq
MIRT2132604	hsa-miR-1207-5p	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2132605	hsa-miR-125a-3p	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT2132606	hsa-miR-142-3p	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT2132607	hsa-miR-3150a-5p	CLIP-seq
MIRT2132608	hsa-miR-3150b-5p	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT1443052	hsa-miR-3663-5p	CLIP-seq
MIRT2132609	hsa-miR-3665	CLIP-seq
MIRT2132610	hsa-miR-3677-5p	CLIP-seq
MIRT2132611	hsa-miR-371-5p	CLIP-seq
MIRT1443053	hsa-miR-3929	CLIP-seq
MIRT2132612	hsa-miR-3934	CLIP-seq
MIRT2132613	hsa-miR-3944-5p	CLIP-seq
MIRT2132614	hsa-miR-4280	CLIP-seq
MIRT1443054	hsa-miR-4419b	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443056	hsa-miR-4435	CLIP-seq
MIRT1443057	hsa-miR-4478	CLIP-seq
MIRT2132615	hsa-miR-4634	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT1443062	hsa-miR-4701-5p	CLIP-seq
MIRT2132616	hsa-miR-4736	CLIP-seq
MIRT1443067	hsa-miR-4755-3p	CLIP-seq
MIRT2132617	hsa-miR-4763-3p	CLIP-seq
MIRT1443068	hsa-miR-4772-3p	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT1443074	hsa-miR-548s	CLIP-seq
MIRT1443075	hsa-miR-588	CLIP-seq
MIRT2132618	hsa-miR-601	CLIP-seq
MIRT2132619	hsa-miR-639	CLIP-seq
MIRT2132620	hsa-miR-640	CLIP-seq
MIRT2132621	hsa-miR-645	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT2132622	hsa-miR-764	CLIP-seq
MIRT2132600	hsa-miR-103b	CLIP-seq
MIRT2353571	hsa-miR-106a	CLIP-seq
MIRT2353572	hsa-miR-106b	CLIP-seq
MIRT2132601	hsa-miR-1178	CLIP-seq
MIRT2132602	hsa-miR-1184	CLIP-seq
MIRT2132604	hsa-miR-1207-5p	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2353573	hsa-miR-1225-3p	CLIP-seq
MIRT2353574	hsa-miR-1343	CLIP-seq
MIRT2132606	hsa-miR-142-3p	CLIP-seq
MIRT1443044	hsa-miR-150	CLIP-seq
MIRT2353575	hsa-miR-17	CLIP-seq
MIRT2353576	hsa-miR-1825	CLIP-seq
MIRT2353577	hsa-miR-1972	CLIP-seq
MIRT2353578	hsa-miR-199a-5p	CLIP-seq
MIRT2353579	hsa-miR-199b-5p	CLIP-seq
MIRT2353580	hsa-miR-20a	CLIP-seq
MIRT2353581	hsa-miR-20b	CLIP-seq
MIRT2353582	hsa-miR-302a	CLIP-seq
MIRT2353583	hsa-miR-302b	CLIP-seq
MIRT2353584	hsa-miR-302c	CLIP-seq
MIRT2353585	hsa-miR-302d	CLIP-seq
MIRT2353586	hsa-miR-302e	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT2353587	hsa-miR-3166	CLIP-seq
MIRT2353588	hsa-miR-3180-5p	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT2353589	hsa-miR-3614-5p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2132610	hsa-miR-3677-5p	CLIP-seq
MIRT2132611	hsa-miR-371-5p	CLIP-seq
MIRT2353590	hsa-miR-372	CLIP-seq
MIRT2353591	hsa-miR-373	CLIP-seq
MIRT2353592	hsa-miR-378g	CLIP-seq
MIRT2353593	hsa-miR-3925-3p	CLIP-seq
MIRT2132614	hsa-miR-4280	CLIP-seq
MIRT2353594	hsa-miR-4427	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT2353595	hsa-miR-4437	CLIP-seq
MIRT2353596	hsa-miR-4457	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT2132615	hsa-miR-4634	CLIP-seq
MIRT2353597	hsa-miR-4674	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT2353598	hsa-miR-4714-3p	CLIP-seq
MIRT2353599	hsa-miR-4717-5p	CLIP-seq
MIRT1443066	hsa-miR-4731-3p	CLIP-seq
MIRT2353600	hsa-miR-4731-5p	CLIP-seq
MIRT2132616	hsa-miR-4736	CLIP-seq
MIRT2353601	hsa-miR-4749-3p	CLIP-seq
MIRT2132617	hsa-miR-4763-3p	CLIP-seq
MIRT1443071	hsa-miR-4801	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT2353602	hsa-miR-512-3p	CLIP-seq
MIRT2353603	hsa-miR-519d	CLIP-seq
MIRT2353604	hsa-miR-520a-3p	CLIP-seq
MIRT2353605	hsa-miR-520b	CLIP-seq
MIRT2353606	hsa-miR-520c-3p	CLIP-seq
MIRT2353607	hsa-miR-520d-3p	CLIP-seq
MIRT2353608	hsa-miR-520e	CLIP-seq
MIRT2353609	hsa-miR-520g	CLIP-seq
MIRT2353610	hsa-miR-520h	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT2132619	hsa-miR-639	CLIP-seq
MIRT2353611	hsa-miR-665	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2353612	hsa-miR-93	CLIP-seq
MIRT2132600	hsa-miR-103b	CLIP-seq
MIRT2132602	hsa-miR-1184	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT2396115	hsa-miR-193b	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT2353589	hsa-miR-3614-5p	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2132611	hsa-miR-371-5p	CLIP-seq
MIRT2396116	hsa-miR-4258	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT2396117	hsa-miR-4529-5p	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT2396118	hsa-miR-4707-3p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT1443068	hsa-miR-4772-3p	CLIP-seq
MIRT2396120	hsa-miR-4796-3p	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT2353609	hsa-miR-520g	CLIP-seq
MIRT2353610	hsa-miR-520h	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT2132619	hsa-miR-639	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2132604	hsa-miR-1207-5p	CLIP-seq
MIRT2396115	hsa-miR-193b	CLIP-seq
MIRT1443049	hsa-miR-3187-3p	CLIP-seq
MIRT2353589	hsa-miR-3614-5p	CLIP-seq
MIRT2441447	hsa-miR-4260	CLIP-seq
MIRT2441448	hsa-miR-4436b-3p	CLIP-seq
MIRT1443058	hsa-miR-450b-3p	CLIP-seq
MIRT2396117	hsa-miR-4529-5p	CLIP-seq
MIRT1443063	hsa-miR-4713-3p	CLIP-seq
MIRT2132616	hsa-miR-4736	CLIP-seq
MIRT2132617	hsa-miR-4763-3p	CLIP-seq
MIRT2396120	hsa-miR-4796-3p	CLIP-seq
MIRT2353609	hsa-miR-520g	CLIP-seq
MIRT2353610	hsa-miR-520h	CLIP-seq
MIRT1443077	hsa-miR-638	CLIP-seq
MIRT1443079	hsa-miR-769-3p	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443046	hsa-miR-3155	CLIP-seq
MIRT1443047	hsa-miR-3155b	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT2462066	hsa-miR-4446-3p	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT2462068	hsa-miR-4715-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT1443072	hsa-miR-484	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT2647785	hsa-miR-1197	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT2647786	hsa-miR-3135	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443048	hsa-miR-3170	CLIP-seq
MIRT2647787	hsa-miR-3650	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT2647788	hsa-miR-4428	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443059	hsa-miR-4532	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT2647789	hsa-miR-644	CLIP-seq
MIRT2647790	hsa-miR-663b	CLIP-seq
MIRT1443038	hsa-miR-122	CLIP-seq
MIRT2462063	hsa-miR-1273f	CLIP-seq
MIRT1443043	hsa-miR-1307	CLIP-seq
MIRT1443045	hsa-miR-3135b	CLIP-seq
MIRT1443051	hsa-miR-3652	CLIP-seq
MIRT2462064	hsa-miR-3686	CLIP-seq
MIRT2462065	hsa-miR-411	CLIP-seq
MIRT2693702	hsa-miR-4279	CLIP-seq
MIRT2693703	hsa-miR-4297	CLIP-seq
MIRT1443055	hsa-miR-4430	CLIP-seq
MIRT1443060	hsa-miR-4638-5p	CLIP-seq
MIRT2462067	hsa-miR-4652-3p	CLIP-seq
MIRT1443061	hsa-miR-4695-3p	CLIP-seq
MIRT2396119	hsa-miR-4735-5p	CLIP-seq
MIRT2462069	hsa-miR-4742-3p	CLIP-seq
MIRT2693704	hsa-miR-532-5p	CLIP-seq
MIRT1443078	hsa-miR-720	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
JUN	Activation	9743209

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002718	Process	Regulation of cytokine production involved in immune response	IEA
GO:0002718	Process	Regulation of cytokine production involved in immune response	ISS
GO:0002724	Process	Regulation of T cell cytokine production	IBA
GO:0002724	Process	Regulation of T cell cytokine production	IEA
GO:0002724	Process	Regulation of T cell cytokine production	ISS
GO:0002947	Component	Tumor necrosis factor receptor superfamily complex	TAS	24966471
GO:0003176	Process	Aortic valve development	IEA
GO:0003176	Process	Aortic valve development	ISS
GO:0003177	Process	Pulmonary valve development	IEA
GO:0003177	Process	Pulmonary valve development	ISS
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	IEA
GO:0003332	Process	Negative regulation of extracellular matrix constituent secretion	ISS
GO:0005031	Function	Tumor necrosis factor receptor activity	IBA
GO:0005031	Function	Tumor necrosis factor receptor activity	IEA
GO:0005031	Function	Tumor necrosis factor receptor activity	TAS	8702885
GO:0005515	Function	Protein binding	IPI	8069916, 10848577, 11244088, 14743216, 24070898, 25609706, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	24966471
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11279055
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0031643	Process	Positive regulation of myelination	IBA
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS	24966471
GO:0035579	Component	Specific granule membrane	TAS
GO:0042129	Process	Regulation of T cell proliferation	IBA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042129	Process	Regulation of T cell proliferation	ISS
GO:0043120	Function	Tumor necrosis factor binding	IBA
GO:0043120	Function	Tumor necrosis factor binding	IPI	9435233
GO:0045121	Component	Membrane raft	IDA	17010968
GO:0045121	Component	Membrane raft	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IBA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050779	Process	RNA destabilization	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IBA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IMP	22480688
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	22480688
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IBA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	IEA
GO:0150077	Process	Regulation of neuroinflammatory response	ISS
GO:0150079	Process	Negative regulation of neuroinflammatory response	IBA
GO:0150079	Process	Negative regulation of neuroinflammatory response	IEA
GO:0150079	Process	Negative regulation of neuroinflammatory response	ISS
GO:0150098	Process	Glial cell-neuron signaling	IEA
GO:0150098	Process	Glial cell-neuron signaling	ISS
GO:1902339	Process	Positive regulation of apoptotic process involved in morphogenesis	IEA
GO:1902339	Process	Positive regulation of apoptotic process involved in morphogenesis	ISS

MIM	HGNC	e!Ensembl
191191	11917	ENSG00000028137

P20333

Protein name

Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis fac

Protein function

Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor media

PDB

1CA9 , 3ALQ , 8HLB , 9CU8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00020	TNFR_c6	40 → 75	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	78 → 118	TNFR/NGFR cysteine-rich region	Domain
PF00020	TNFR_c6	120 → 161	TNFR/NGFR cysteine-rich region	Domain

Sequence

MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS

Sequence length

461

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Associated with severe COVID-19 disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLASSIC MYCOSIS FUNGOIDES	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERSENSITIVITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS NEPHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARANOID SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19)	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19) due to high plasma levels of TNF, TNFR, and/or TNFR2	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Susceptibility to severe coronavirus disease (COVID-19) due to high plasma levels of TNF, TNFR, and/or TNFR3	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (410)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	20861605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	20861605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16173964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15146559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15948150, 20464497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23672298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	29928327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11163081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	10399751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	21593780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22626591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	15929959, 32305453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20110607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15056289, 21908873, 24475283, 28228570, 28698670, 29081600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	18083240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16142859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	16142859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	12100146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19772798, 22984424, 25061744, 30075559		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	14613990, 30927045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	LHGDN	15851552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	30185417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11854734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	29158612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	11854734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	11854734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23249640, 30292879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	23249640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15252214, 16947419, 21346237, 29218573, 29339199, 29342501, 29375132, 29618659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	18415772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29306244, 39954509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11212177, 12209506, 12209507, 14872483, 15022314, 16207322, 19370184, 23784528, 24782596, 25436214, 27270893, 27640805, 31338093, 31906244, 31953914, 36012570, 36611799 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	12011375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	21912093, 32032632, 35681430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23249640, 30292879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	16139734		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	30524316		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11169260, 22105853, 25378394, 26071216, 28235800, 29342501, 29559979, 29623079, 29632537, 29748156, 29967617, 30206422, 30631042, 30856027, 31220564, 31578241, 31597740 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	29339359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	8329708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	12770792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	LHGDN	18415772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	32093803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	10893687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	32167668	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12438259, 14997042, 15863392, 20127018, 25010932, 25292037, 28677724, 28789455, 29202842, 29295954, 30910714, 31239840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	27881867	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16984377, 25010932, 25928089, 36865537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	27211902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32073741, 35979166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16425355, 29425759	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36865537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	16984377	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	7509279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29080421, 30989732, 31559061, 31848339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20430728	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37589506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26992212, 27362805, 34221297, 38537932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30414907	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36865537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21760883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24511008, 29163543, 29802567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	8640999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	8640999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22088456, 28256549, 31813103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	29686027	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	19900796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central visual impairment	Central Visual Impairment	BEFREE	11472434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11358448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	33918875	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11358448		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27145290, 29435163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29435163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27145290, 29435163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	28704293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	17700442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28256549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8329708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21037022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15142217		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31785393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25153701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26990631	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	11781288, 15842589, 25387791, 30457980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24379584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18088549, 21994466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	14614330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16477629, 24762198, 27504605, 28123565, 28412748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15743036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21994466, 24379584, 25244921, 28412748, 31877663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	LHGDN	17825894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	29915336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29806700, 30941924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	19039234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	22921902, 28359413, 28367848, 30856027, 9799654		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20566746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11357933, 20395596, 23249640, 29547707, 29686027, 30097271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11357933, 17346438, 20395596, 29547707, 29686027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23249640	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	29686027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11357933, 20395596, 29547707, 29686027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	15920055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11196680, 11781288, 11904678, 12049175, 15842589, 24121042, 26071216, 29848778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	11904678, 15784704, 18248655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29848778, 33767696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30472484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36045687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11508576, 12913922, 1320571, 16871413, 30826358, 31261789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	37156856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	16458261, 17094069, 24047966, 24094876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	17094069, 24047966, 28839357, 28867280		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	27991935	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	29799484	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	27138824, 27232630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10856157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	10399751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Detrusor and sphincter dyssynergia	Detrusor And Sphincter Dyssynergia	BEFREE	29806700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10946317, 18566344, 22068019, 25200302, 31073629, 31813103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	28367848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10946317, 18566344, 22068019, 23065828, 25200302, 31073629, 31813103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28367848	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21584225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21849023, 28367848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36614270	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26786322, 28843039, 31813103, 9174153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11315843, 15217754, 15787661, 16979382, 21849023, 28367848, 30333553, 31813103		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	11882518		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	11882518		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26928194, 33122288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27003829, 28476763, 31207020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23672298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27293319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	15787661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia unguium	Nail dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	15866349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10856157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	10931145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37233761, 38013616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	14506926, 18510047		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	15212671, 19238748, 24844917		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	18061173, 18976764	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	24844917, 38013616	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	28821608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	27006531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	12032115, 18398367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29163543, 29802567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20646319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11315843, 15925743, 19557004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	40420032	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	8899002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29080421, 7578985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	20353583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	19142969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	19142969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	28859856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30632412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27858267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27858267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17696644, 25538243, 30092219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31649684, 34798125	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19169037, 22449555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	11979305, 12734353, 29593717, 29632537, 31555271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	11979305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	18571427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	27458112, 9174153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	LHGDN	18717726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28946816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30734494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	22790687, 22921902	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	22921902, 28359413, 28367848, 30856027		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	28367848	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	29425759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	29915336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1691591, 29928327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	31877663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24285878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	33316770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	12161545, 19039234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	LHGDN	12161545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	Pubtator	12161545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	10942422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	20506408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10320052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10320052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	10958645, 16054550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	20506408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10942422, 16003175, 16216983, 19557004, 23337087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	CTD_human_DG	15044820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	19473970	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36244759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	11371414, 21144722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	15809201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28389814		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25153701, 28380447, 28969308, 29604364, 30374941, 31543761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	17207711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11781288, 27104820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	21994466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23651848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	15274667, 17030185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	16142859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	27104820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11961180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	16275928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	28702675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16198418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	26928194, 34045516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28389814, 31813103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28256549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	33027529, 37554265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1382704, 29922294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24757092	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12893766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1835747, 2146981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24757092, 29922294, 8445947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12149223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	18206417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16109524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	20353583		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	16425355, 29915336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29915336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33246355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	21144722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	21144722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26280204, 30989732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12739039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11762942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12739039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10395102, 10643707, 10703622, 11169260, 11196716, 11197692, 11600223, 11607787, 11762942, 12739039, 15674653, 16306881, 19684152, 20516030, 30185417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12739039, 17028114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12739039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26280204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	29504848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29928327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	16763612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	29930163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29930163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	23593415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	31541282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18081157, 21938001, 26278479, 28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23576602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15084380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438259, 17018605, 20127018, 25010932, 25292037, 28677724, 28789455, 29202842, 29295954, 30910714, 31239840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30741921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29080421, 30989732, 31559061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30927045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15948150, 17143529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31040894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17143529, 18974393, 19656388, 20646319, 27626702, 28096506, 28677724, 29032004, 29559979, 29632537, 29892300, 29967617, 30524877, 30856027, 31040894, 31383403, 31578241, 7485723 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27145290, 29435163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18088549, 21994466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19738070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10353757	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12789270, 21418516, 8305739, 8908597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24778320, 31924735, 35879777, 36865537, 8305739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	16458261, 17094069, 24047966, 24094876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	17094069, 24047966, 28839357, 28867280		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	16979382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	10942422, 16645020, 16979382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	22342236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	31953914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	18976764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	15146559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21850048, 31877663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28476134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14651520, 22105853, 28052249, 29690885, 29760711, 30206422, 30856027, 31220564, 31785393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37903821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	19246939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	26258847, 26918607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	14728878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29749399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	17018605, 18403643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17018605, 18403643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	17852784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29547707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30734494, 8640999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	10399751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	15217754	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	11144293, 11285131, 12601524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19095579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	15461705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11389056, 11705863, 14997042, 15084380, 15342406, 16555252, 17143529, 17973327, 18088549, 18974393, 19142969, 19738070, 20224295, 20646319, 21995493 View all (25 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	21221075, 25378394		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	15827736, 24475283, 28380447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	16001231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14654552, 16215672, 19142969, 20404560, 23314735, 24253178, 8656283, 9136990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21419569, 7777541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	15827736, 29604364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	11315843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	20353583		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21995493, 30628200, 30989732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	20353583		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	10841005, 12161545, 16216983, 16503147, 16979382, 18685868		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	11782876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	16784178	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	18685868	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	16503147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	9682783	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	16282562, 16871413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19151030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	15071724, 16502120, 17002564		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	17002564	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19263582, 31877663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	28158970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30927045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	14613990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35048633, 37589506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12741461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	30254506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	20842464, 28761093, 30254506		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paranoid Schizophrenia	Paranoid Schizophrenia	PSYGENET_DG	20842464		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	24475283, 30941646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	32926429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29889832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	20395596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	20818983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	20395596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	8807591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	12032115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	14997042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	29973541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Poikiloderma	Poikiloderma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis	Polyarthritis	BEFREE	29618659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	12161545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12161545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	12161545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	11055823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29749399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	30842294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	23258148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15948150, 17143529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33326414, 37108754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	28158970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	12011375, 22111980, 25537528, 26071216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21912093, 25155252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28744116	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	24762198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	25311255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	39266570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	25086184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16555252, 17973327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	31266060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	31266060	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10765919, 11212177, 11508576, 12209506, 12209507, 12610797, 12730509, 12858434, 12913922, 1320571, 14687710, 14872483, 15022314, 15252214, 15603867 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12209506, 12233877, 12610797, 12858434, 14872483, 15022314, 15603867, 16142859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	22626591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	16189158	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	16889950, 27158798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27158798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11126399, 20842464, 30254506		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	11126399, 20842464		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24743863, 30254506, 32093803, 34103471, 35027554	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	30254506	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Paranoid	Schizophrenia	Pubtator	30254506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	35674522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	ORPHANET_DG	26258847		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26258847		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary syndrome	Pubtator	26258847, 30356161	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
	Sezary Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	30356161		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	27180164, 29504848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	21760883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	29618659, 31609517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25061744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	25010932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18206417, 21760883, 30268558, 30895287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18206417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16951226, 20646319, 24151445, 28534989, 28560678, 28819854, 29920311, 30127886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26113409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	26113409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28447720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31040894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31659258, 33661721, 34766338, 35979166, 37747314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	22167233, 33918875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	15585313, 28859262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	11169260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	27458112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	22146561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	29777731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	29777731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11588035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31839752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35228654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11781288, 11904678, 15274667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	11904678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18081157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25113639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20395596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37575057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	11169260		★★★★★ ★☆☆☆☆ Found in Text Mining only

TNFRSF1B (TNF receptor superfamily member 1B)