Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55254
Gene name	Transmembrane protein 39A
Gene symbol	TMEM39A
Synonyms (NCBI Gene)	SUSR2
Chromosome	3
Chromosome location	3q13.33

82 Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052363	hsa-let-7a-5p	CLASH	23622248
MIRT1436969	hsa-miR-1185	CLIP-seq
MIRT1436970	hsa-miR-299-3p	CLIP-seq
MIRT1436971	hsa-miR-3166	CLIP-seq
MIRT1436972	hsa-miR-3605-5p	CLIP-seq
MIRT1436973	hsa-miR-3616-3p	CLIP-seq
MIRT1436974	hsa-miR-3617	CLIP-seq
MIRT1436975	hsa-miR-3679-5p	CLIP-seq
MIRT1436976	hsa-miR-4265	CLIP-seq
MIRT1436977	hsa-miR-4296	CLIP-seq
MIRT1436978	hsa-miR-4322	CLIP-seq
MIRT1436979	hsa-miR-433	CLIP-seq
MIRT1436980	hsa-miR-4417	CLIP-seq
MIRT1436981	hsa-miR-4509	CLIP-seq
MIRT1436982	hsa-miR-4684-5p	CLIP-seq
MIRT1436983	hsa-miR-4721	CLIP-seq
MIRT1436984	hsa-miR-4744	CLIP-seq
MIRT1436985	hsa-miR-4760-5p	CLIP-seq
MIRT1436986	hsa-miR-4764-3p	CLIP-seq
MIRT1436987	hsa-miR-488	CLIP-seq
MIRT1436988	hsa-miR-641	CLIP-seq
MIRT2130990	hsa-miR-1207-3p	CLIP-seq
MIRT2130991	hsa-miR-1224-5p	CLIP-seq
MIRT2130992	hsa-miR-1305	CLIP-seq
MIRT2130993	hsa-miR-150	CLIP-seq
MIRT2130994	hsa-miR-3121-3p	CLIP-seq
MIRT2130995	hsa-miR-3673	CLIP-seq
MIRT2130996	hsa-miR-4639-3p	CLIP-seq
MIRT2130997	hsa-miR-4713-5p	CLIP-seq
MIRT2130998	hsa-miR-4714-3p	CLIP-seq
MIRT2130999	hsa-miR-4751	CLIP-seq
MIRT2131000	hsa-miR-532-3p	CLIP-seq
MIRT2131001	hsa-miR-890	CLIP-seq
MIRT2131002	hsa-miR-935	CLIP-seq
MIRT2130990	hsa-miR-1207-3p	CLIP-seq
MIRT2130991	hsa-miR-1224-5p	CLIP-seq
MIRT2352222	hsa-miR-200b	CLIP-seq
MIRT2352223	hsa-miR-200c	CLIP-seq
MIRT2352224	hsa-miR-429	CLIP-seq
MIRT2352225	hsa-miR-4445	CLIP-seq
MIRT2130999	hsa-miR-4751	CLIP-seq
MIRT2352226	hsa-miR-4803	CLIP-seq
MIRT2396009	hsa-miR-298	CLIP-seq
MIRT2396010	hsa-miR-4261	CLIP-seq
MIRT2396011	hsa-miR-4795-5p	CLIP-seq
MIRT2396012	hsa-miR-671-5p	CLIP-seq
MIRT2646017	hsa-miR-1236	CLIP-seq
MIRT2646018	hsa-miR-1323	CLIP-seq
MIRT2646019	hsa-miR-188-5p	CLIP-seq
MIRT2352222	hsa-miR-200b	CLIP-seq
MIRT2352223	hsa-miR-200c	CLIP-seq
MIRT2646020	hsa-miR-300	CLIP-seq
MIRT2646021	hsa-miR-381	CLIP-seq
MIRT2352224	hsa-miR-429	CLIP-seq
MIRT2646022	hsa-miR-4643	CLIP-seq
MIRT2646023	hsa-miR-4666-3p	CLIP-seq
MIRT2646024	hsa-miR-4788	CLIP-seq
MIRT2352226	hsa-miR-4803	CLIP-seq
MIRT2646025	hsa-miR-499-3p	CLIP-seq
MIRT2646026	hsa-miR-499a-3p	CLIP-seq
MIRT2646027	hsa-miR-548o	CLIP-seq
MIRT2646028	hsa-miR-550b	CLIP-seq
MIRT2646029	hsa-miR-607	CLIP-seq
MIRT2646030	hsa-miR-633	CLIP-seq
MIRT2646031	hsa-miR-889	CLIP-seq
MIRT2646017	hsa-miR-1236	CLIP-seq
MIRT2646018	hsa-miR-1323	CLIP-seq
MIRT2646019	hsa-miR-188-5p	CLIP-seq
MIRT2693519	hsa-miR-338-5p	CLIP-seq
MIRT2693520	hsa-miR-425	CLIP-seq
MIRT2646022	hsa-miR-4643	CLIP-seq
MIRT2646024	hsa-miR-4788	CLIP-seq
MIRT2352226	hsa-miR-4803	CLIP-seq
MIRT2646025	hsa-miR-499-3p	CLIP-seq
MIRT2646026	hsa-miR-499a-3p	CLIP-seq
MIRT2646027	hsa-miR-548o	CLIP-seq
MIRT2693521	hsa-miR-549	CLIP-seq
MIRT2646028	hsa-miR-550b	CLIP-seq
MIRT2693522	hsa-miR-570	CLIP-seq
MIRT2646029	hsa-miR-607	CLIP-seq
MIRT2646030	hsa-miR-633	CLIP-seq
MIRT2646031	hsa-miR-889	CLIP-seq

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	31806350, 31849860
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	31806350
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006914	Process	Autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IDA	31849860
GO:1901097	Process	Negative regulation of autophagosome maturation	IBA
GO:1901097	Process	Negative regulation of autophagosome maturation	IMP	31806350
GO:1902902	Process	Negative regulation of autophagosome assembly	IBA
GO:1902902	Process	Negative regulation of autophagosome assembly	IMP	31806350

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NV64

Protein name

Transmembrane protein 39A

Protein function

Regulates autophagy by controlling the spatial distribution and levels of the intracellular phosphatidylinositol 4-phosphate (PtdIns(4)P) pools (PubMed:31806350). Modulates (PtdIns(4)P) levels by regulating the ER-to-Golgi trafficking of the pho

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10271	Tmp39	42 → 477	Putative transmembrane protein	Family

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in brain tumor glioblastoma multiforme cells (at protein level). {ECO:0000269|PubMed:28133515}.

Sequence

MPGGRRGPSRQQLSRSALPSLQTLVGGGCGNGTGLRNRNGSAIGLPVPPITALITPGPVR
HCQIPDLPVDGSLLFEFLFFIYLLVALFIQYINIYKTVWWYPYNHPASCTSLNFHLIDYH
LAAFITVMLARRLVWALISEATKAGAASMIHYMVLISARLVLLTLCGWVLCWTLVNLFRS
HSVLNLLFLGYPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDF
LSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAYYVA
FLPLCFVKSTQYYDMRWSCEHLIMVWINAFVMLTTQLLPSKYCDLLHKSAAHLGKWQKLE
HGSYSNAPQHIWSENTIWPQGVLVRHSRCLYRAMGPYNVAVPSDVSHARFYFLFHRPLRL
LNLLILIEGSVVFYQLYSLLRSEKWNHTLSMALILFCNYYVLFKLLRDRIVLGRAYSYPL
NSYELKAN

Sequence length

488

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	28425483	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	28425483	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	28714469, 36750564	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22194214, 31553233, 31806350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	39237981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22464253, 25890262, 28427360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22464253	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22464253, 25890262, 28427360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20007504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20007504, 22194214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	21399635, 22961000		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	28425483		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TMEM39A (transmembrane protein 39A)

Bookmark This Gene